SPIB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPIB_HUMAN
• UniProt AC: Q01892
• Protein Name: Transcription factor Spi-B
• Gene Name: SPIB
• Organism: Homo sapiens (Human).
• Sequence Length: 262
• Subcellular Localization: Isoform 1: Nucleus .; Isoform 2: Cytoplasm .
• Protein Description: Sequence specific transcriptional activator which binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. Promotes development of plasmacytoid dendritic cells (pDCs), also known as type 2 DC precursors (pre-DC2) or natural interferon (IFN)-producing cells. These cells have the capacity to produce large amounts of interferon and block viral replication. May be required for B-cell receptor (BCR) signaling, which is necessary for normal B-cell development and antigenic stimulation..
• Protein Sequence: MLALEAAQLDGPHFSCLYPDGVFYDLDSCKHSSYPDSEGAPDSLWDWTVAPPVPATPYEAFDPAAAAFSHPQAAQLCYEPPTYSPAGNLELAPSLEAPGPGLPAYPTENFASQTLVPPAYAPYPSPVLSEEEDLPLDSPALEVSDSESDEALVAGPEGKGSEAGTRKKLRLYQFLLGLLTRGDMRECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Phosphorylation	KHSSYPDSEGAPDSL CCCCCCCCCCCCCCC	33.16	10618498
56	Phosphorylation	VAPPVPATPYEAFDP CCCCCCCCCCHHCCH	21.97	8632909
129	Phosphorylation	PYPSPVLSEEEDLPL CCCCCCCCCCCCCCC	43.10	10618498
144	Phosphorylation	DSPALEVSDSESDEA CCCCEECCCCCCCCC	26.50	10618498
146	Phosphorylation	PALEVSDSESDEALV CCEECCCCCCCCCEE	31.34	10618498

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
37	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
37	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM
56	T	Phosphorylation	Kinase	MAPK3	P27361	GPS
129	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
129	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM
144	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
144	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM
146	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
146	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPIB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPIB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MK03_HUMAN	MAPK3	physical	8632909
MK08_HUMAN	MAPK8	physical	8632909
SPIB_HUMAN	SPIB	physical	10196196
TBP_HUMAN	TBP	physical	10196196
SPI1_HUMAN	SPI1	physical	10196196
JUN_HUMAN	JUN	physical	10196196
LA_HUMAN	SSB	physical	21988832
CCGL_HUMAN	TMEM37	physical	21988832
EP300_HUMAN	EP300	physical	11864910

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.