UniProt ID | DIMI_SCHPO | |
---|---|---|
UniProt AC | P87215 | |
Protein Name | Mitosis protein dim1 | |
Gene Name | dim1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 142 | |
Subcellular Localization | Nucleus. | |
Protein Description | Plays a fundamental role as a protein essential for entry into mitosis (G2/M progression) as well as for chromosome segregation during mitosis. May play a role in mitotic spindle formation and/or function. May have a role in the maintenance or establishment of the steady-state level of the APC complex.. | |
Protein Sequence | MSYFLPHLHSGWHVDQAILSEQERLVVIRFGRDHDEECIKQDEVLYRIAEKVVNMAVIYLVDIDEVPDFNKMYELYDRTTIMFFYRNKHMMIDLGTGNNNKINWPLEDKQEMIDIIETIFRGARKGKGLVISPKDYSTRHRY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of DIMI_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DIMI_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DIMI_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DIMI_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRP1_SCHPO | prp1 | physical | 15755920 | |
YCRE_SCHPO | trs130 | genetic | 22681890 | |
YNSK_SCHPO | any1 | genetic | 22681890 | |
SWR1_SCHPO | swr1 | genetic | 22681890 | |
YJ74_SCHPO | SPCC757.04 | genetic | 22681890 | |
ARF6_SCHPO | arf6 | genetic | 22681890 | |
YN8E_SCHPO | SPBP35G2.14 | genetic | 22681890 | |
YK82_SCHPO | bdf2 | genetic | 22681890 | |
DAD1_SCHPO | dad1 | genetic | 22681890 | |
YK72_SCHPO | SPAC732.02c | genetic | 22681890 | |
MU113_SCHPO | mug113 | genetic | 22681890 | |
UPS2_SCHPO | SPBC36.10 | genetic | 22681890 | |
RSC4_SCHPO | rsc4 | genetic | 22681890 | |
SWC3_SCHPO | swc3 | genetic | 22681890 | |
ASH2_SCHPO | ash2 | genetic | 22681890 | |
RTN1_SCHPO | rtn1 | genetic | 22681890 | |
POF9_SCHPO | pof9 | genetic | 22681890 | |
FSV1_SCHPO | fsv1 | genetic | 22681890 | |
HIS2_SCHPO | his7 | genetic | 22681890 | |
YOI9_SCHPO | SPBC1778.09 | genetic | 22681890 | |
SNT2_SCHPO | snt2 | genetic | 22681890 | |
VPS72_SCHPO | swc2 | genetic | 22681890 | |
ASK1_SCHPO | ask1 | genetic | 22681890 | |
BIOB_SCHPO | bio2 | genetic | 22681890 | |
SDE2_SCHPO | sde2 | genetic | 22681890 | |
YKN4_SCHPO | mca1 | genetic | 22681890 | |
MOK11_SCHPO | mok11 | genetic | 22681890 | |
YI43_SCHPO | SPBC1348.03 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...