| UniProt ID | DCTN2_CAEEL | |
|---|---|---|
| UniProt AC | Q09248 | |
| Protein Name | Probable dynactin subunit 2 | |
| Gene Name | dnc-2 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 331 | |
| Subcellular Localization |
Cytoplasm, cytoskeleton. Membrane Peripheral membrane protein. |
|
| Protein Description | Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. May play a role in synapse formation during brain development (By similarity).. | |
| Protein Sequence | MSSIGKEDIYESDGAASQVQKSEPENDNPTHPDIELISVDVDEALKKYKNRVLNLTSSDFSDSIAKKRRHAFGNNQYVLEVTGAGFSGTETAAEKLNRILYEVADLNEQIRADENLKTDLLNAEVLENLEKEVKTLQVAQSNGKTARVEHDVELPNVRTDSKVATLENRLRRIEQVIGSSVIPSAPVLDTIEDLKLRCETLNHSYVSGLEQRLNMMLTKLEKIDETRANNDIDENLDKKVDEILELMQKWDVACSSLPSNVNKVKALNRLHEQVQHFAGGLSHLKTIREKLEKEVAQGREAIIEYESQGKQEIGSVVEKLKLLEAKVADLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Phosphorylation | GKEDIYESDGAASQV CHHHHCCCCCCHHHH | 25.11 | 30078680 | |
| 56 | Phosphorylation | KNRVLNLTSSDFSDS HHHHHHCCCCCCCHH | 25.72 | 30078680 | |
| 57 | Phosphorylation | NRVLNLTSSDFSDSI HHHHHCCCCCCCHHH | 30.95 | 30078680 | |
| 58 | Phosphorylation | RVLNLTSSDFSDSIA HHHHCCCCCCCHHHH | 37.12 | 30078680 | |
| 61 | Phosphorylation | NLTSSDFSDSIAKKR HCCCCCCCHHHHHHH | 35.12 | 30078680 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCTN2_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCTN2_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCTN2_CAEEL !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TECR_CAEEL | art-1 | physical | 14704431 | |
| DCTN2_CAEEL | dnc-2 | physical | 14704431 | |
| ATPB_CAEEL | atp-2 | physical | 14704431 | |
| IFB1_CAEEL | ifb-1 | physical | 14704431 | |
| TCTP_CAEEL | tct-1 | physical | 14704431 | |
| GBLP_CAEEL | rack-1 | physical | 14704431 | |
| LEC1_CAEEL | lec-1 | physical | 14704431 | |
| CSN5_CAEEL | csn-5 | physical | 18692475 | |
| DCTN2_CAEEL | dnc-2 | physical | 18692475 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
