GBLP_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBLP_CAEEL
• UniProt AC: Q21215
• Protein Name: Guanine nucleotide-binding protein subunit beta-2-like 1
• Gene Name: rack-1
• Organism: Caenorhabditis elegans.
• Sequence Length: 325
• Protein Description: Required for the expression of antimicrobial peptide nlp-29 in response to fungal infection or physical injury..
• Protein Sequence: MVQEQMKLTGTLEGHTGWVTQIATYTRNDKTTVLSSSRDKTILVWDVDSVAPVDEGPIGRPVRSLTGHNHFVSDVVISSDGQFALSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFSADNRQIVSGSRDKSIKLWNTLAQCKYTITDDCHTDWVSTVRFSPSNRDPVIVSAGWDKVVKVWNLGNCRLKTNHIGHTGYVNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLPGNDVINAMSFSPNRYWLCAAVGSSIKIWDLEDKKEIEELKPEIASSGSSRGSSPQCISLAWSQDGQTLFAGYTDNIIRVYQVSIRASN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
282	Phosphorylation	ELKPEIASSGSSRGS HHCHHHHCCCCCCCC	40.67	28854356
283	Phosphorylation	LKPEIASSGSSRGSS HCHHHHCCCCCCCCC	33.40	28854356
285	Phosphorylation	PEIASSGSSRGSSPQ HHHHCCCCCCCCCCC	20.86	28854356
286	Phosphorylation	EIASSGSSRGSSPQC HHHCCCCCCCCCCCE	44.16	19060867
324	Phosphorylation	YQVSIRASN------ EEEEEECCC------	32.97	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBLP_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBLP_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBLP_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.