UniProt ID | LEC1_CAEEL | |
---|---|---|
UniProt AC | P36573 | |
Protein Name | 32 kDa beta-galactoside-binding lectin | |
Gene Name | lec-1 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 279 | |
Subcellular Localization | ||
Protein Description | Binds galactose.. | |
Protein Sequence | MSAEEPKSYPVPYRSVLQEKFEPGQTLIVKGSTIDESQRFTINLHSKTADFSGNDVPLHVSVRFDEGKIVLNSFSNGEWGKEERKSNPIKKGDSFDIRIRAHDDRFQIIVDHKEFKDYEHRLPLSSISHLSIDGDLYLNHVHWGGKYYPVPYESGLANGLPVGKSLLVFGTVEKKAKRFHVNLLRKNGDISFHFNPRFDEKHVIRNSLAANEWGNEEREGKNPFEKGVGFDLVIQNEEYAFQVFVNGERYISFAHRADPHDIAGLQISGDIELSGIQIQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | SAEEPKSYPVPYRSV CCCCCCCCCCCCHHH | 17.86 | 27067626 | |
61 | Phosphorylation | NDVPLHVSVRFDEGK CCCEEEEEEECCCCE | 9.23 | 30078680 | |
75 | Phosphorylation | KIVLNSFSNGEWGKE EEEEEEECCCCCCCC | 43.69 | 28854356 | |
94 | Phosphorylation | NPIKKGDSFDIRIRA CCCCCCCCEEEEEEE | 33.22 | 22923814 | |
147 | Phosphorylation | HVHWGGKYYPVPYES CCEECCEECCCCCCC | 19.10 | 27067626 | |
148 | Phosphorylation | VHWGGKYYPVPYESG CEECCEECCCCCCCC | 10.97 | 27067626 | |
165 | Phosphorylation | NGLPVGKSLLVFGTV CCCCCCCEEEEEEEH | 22.47 | 28854356 | |
171 | Phosphorylation | KSLLVFGTVEKKAKR CEEEEEEEHHHHCCE | 17.64 | 28854356 | |
250 | Phosphorylation | VFVNGERYISFAHRA EEECCEEEEEEEECC | 9.16 | 27067626 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LEC1_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LEC1_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LEC1_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RL8_CAEEL | rpl-2 | physical | 14704431 | |
CSN5_CAEEL | csn-5 | physical | 14704431 | |
UNC93_CAEEL | unc-93 | physical | 14704431 | |
RS9_CAEEL | rps-9 | physical | 14704431 | |
NH111_CAEEL | nhr-111 | physical | 14704431 | |
UNC84_CAEEL | unc-84 | physical | 14704431 | |
PLK3_CAEEL | plk-3 | physical | 14704431 | |
KCC2D_CAEEL | unc-43 | physical | 14704431 | |
IKKE1_CAEEL | ikke-1 | physical | 14704431 | |
ECHM_CAEEL | ech-6 | physical | 14704431 | |
LEC1_CAEEL | lec-1 | physical | 14704431 | |
SAR1_CAEEL | sar-1 | physical | 14704431 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...