| UniProt ID | LEC1_CAEEL | |
|---|---|---|
| UniProt AC | P36573 | |
| Protein Name | 32 kDa beta-galactoside-binding lectin | |
| Gene Name | lec-1 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 279 | |
| Subcellular Localization | ||
| Protein Description | Binds galactose.. | |
| Protein Sequence | MSAEEPKSYPVPYRSVLQEKFEPGQTLIVKGSTIDESQRFTINLHSKTADFSGNDVPLHVSVRFDEGKIVLNSFSNGEWGKEERKSNPIKKGDSFDIRIRAHDDRFQIIVDHKEFKDYEHRLPLSSISHLSIDGDLYLNHVHWGGKYYPVPYESGLANGLPVGKSLLVFGTVEKKAKRFHVNLLRKNGDISFHFNPRFDEKHVIRNSLAANEWGNEEREGKNPFEKGVGFDLVIQNEEYAFQVFVNGERYISFAHRADPHDIAGLQISGDIELSGIQIQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | SAEEPKSYPVPYRSV CCCCCCCCCCCCHHH | 17.86 | 27067626 | |
| 61 | Phosphorylation | NDVPLHVSVRFDEGK CCCEEEEEEECCCCE | 9.23 | 30078680 | |
| 75 | Phosphorylation | KIVLNSFSNGEWGKE EEEEEEECCCCCCCC | 43.69 | 28854356 | |
| 94 | Phosphorylation | NPIKKGDSFDIRIRA CCCCCCCCEEEEEEE | 33.22 | 22923814 | |
| 147 | Phosphorylation | HVHWGGKYYPVPYES CCEECCEECCCCCCC | 19.10 | 27067626 | |
| 148 | Phosphorylation | VHWGGKYYPVPYESG CEECCEECCCCCCCC | 10.97 | 27067626 | |
| 165 | Phosphorylation | NGLPVGKSLLVFGTV CCCCCCCEEEEEEEH | 22.47 | 28854356 | |
| 171 | Phosphorylation | KSLLVFGTVEKKAKR CEEEEEEEHHHHCCE | 17.64 | 28854356 | |
| 250 | Phosphorylation | VFVNGERYISFAHRA EEECCEEEEEEEECC | 9.16 | 27067626 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LEC1_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LEC1_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LEC1_CAEEL !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RL8_CAEEL | rpl-2 | physical | 14704431 | |
| CSN5_CAEEL | csn-5 | physical | 14704431 | |
| UNC93_CAEEL | unc-93 | physical | 14704431 | |
| RS9_CAEEL | rps-9 | physical | 14704431 | |
| NH111_CAEEL | nhr-111 | physical | 14704431 | |
| UNC84_CAEEL | unc-84 | physical | 14704431 | |
| PLK3_CAEEL | plk-3 | physical | 14704431 | |
| KCC2D_CAEEL | unc-43 | physical | 14704431 | |
| IKKE1_CAEEL | ikke-1 | physical | 14704431 | |
| ECHM_CAEEL | ech-6 | physical | 14704431 | |
| LEC1_CAEEL | lec-1 | physical | 14704431 | |
| SAR1_CAEEL | sar-1 | physical | 14704431 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
