TCTP_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCTP_CAEEL
• UniProt AC: Q93573
• Protein Name: Translationally-controlled tumor protein homolog
• Gene Name: tct-1
• Organism: Caenorhabditis elegans.
• Sequence Length: 181
• Subcellular Localization: Cytoplasm.
• Protein Description: Involved in calcium binding and microtubule stabilization..
• Protein Sequence: MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
14	Phosphorylation	IFTDDELSSDSFPMK CCCCCCCCCCCCCCH	30.01	30078680
15	Phosphorylation	FTDDELSSDSFPMKL CCCCCCCCCCCCCHH	50.31	30078680
17	Phosphorylation	DDELSSDSFPMKLVD CCCCCCCCCCCHHHH	32.95	30078680
50	Phosphorylation	VLAGSNPSAEEGAED EEECCCCCHHHCCCC	53.19	21082442
60	Phosphorylation	EGAEDDGSDEHVERG HCCCCCCCHHHHHHC	46.98	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCTP_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCTP_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCTP_CAEEL !!

Protein-Protein Interaction

Oops, there are no PPI records of TCTP_CAEEL !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.