UniProt ID | TCTP_CAEEL | |
---|---|---|
UniProt AC | Q93573 | |
Protein Name | Translationally-controlled tumor protein homolog | |
Gene Name | tct-1 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 181 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Involved in calcium binding and microtubule stabilization.. | |
Protein Sequence | MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | IFTDDELSSDSFPMK CCCCCCCCCCCCCCH | 30.01 | 30078680 | |
15 | Phosphorylation | FTDDELSSDSFPMKL CCCCCCCCCCCCCHH | 50.31 | 30078680 | |
17 | Phosphorylation | DDELSSDSFPMKLVD CCCCCCCCCCCHHHH | 32.95 | 30078680 | |
50 | Phosphorylation | VLAGSNPSAEEGAED EEECCCCCHHHCCCC | 53.19 | 21082442 | |
60 | Phosphorylation | EGAEDDGSDEHVERG HCCCCCCCHHHHHHC | 46.98 | 28854356 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCTP_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCTP_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCTP_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TCTP_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...