dbPTM

TECR_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TECR_CAEEL
UniProt AC	Q9N5Y2
Protein Name	Probable very-long-chain enoyl-CoA reductase art-1
Gene Name	art-1
Organism	Caenorhabditis elegans.
Sequence Length	308
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	Catalyzes the last of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme reduces the trans-2,3-enoyl-CoA fatty acid intermediate to an acyl-CoA that can be further elongated by entering a new cycle of elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators..
Protein Sequence	MSGILEVYDAKRTDNLIITLEGISGSETIKAIKKRIAQKKLKLTEERQALRVEPKGKPLADDQKLSDLGLSSQKAVLYVRDLGPQIAWKTVFMAEYAGPLFVYPLFYLRPTFIYGQAAVNATMHPAVQIAFFAWSFHYAKRLFETQFIHRFGNSTMPQFNLVKNCSYYWGFAAFVAYFVNHPLFTPPAFGDLQVYFGLAGFVISEFGNLSIHILLRNLRPAGTRERRIPKPDGNPLSLLFNYVSCPNYTYEVASWIFFSIMVQSLPAIIFTTAGFAQMAIWAQGKHRNYLKEFPDYPKNRKAIVPFVL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of TECR_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TECR_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TECR_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TECR_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TECR_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TECR_CAEEL

Related Literatures of Post-Translational Modification