dbPTM

CITE4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CITE4_MOUSE
UniProt AC	Q9WUL8
Protein Name	Cbp/p300-interacting transactivator 4
Gene Name	Cited4 {ECO:0000312\|MGI:MGI:1861694}
Organism	Mus musculus (Mouse).
Sequence Length	182
Subcellular Localization	Nucleus. Cytoplasm .
Protein Description	Acts as transcriptional coactivator for TFAP2/AP-2. Enhances estrogen-dependent transactivation mediated by estrogen receptors. May function as an inhibitor of transactivation by HIF1A by disrupting HIF1A interaction with CREBBP. May be involved in regulation of gene expression during development and differentiation of blood cells, endothelial cells and mammary epithelial cells..
Protein Sequence	MADHLMLAEGYCLLQVPPHTHGPHAPRTLQPYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPAAAGGPSPLQPAPGAAASLPPPPPPPALGCMDTELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPAAGSVSC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CITE4_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CITE4_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CITE4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CITE4_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZDHC6_MOUSE	Zdhhc6	physical	20211142
RPC6_MOUSE	Polr3f	physical	20211142
RAI14_MOUSE	Rai14	physical	20211142
CERS2_MOUSE	Cers2	physical	20211142
SIR1_MOUSE	Sirt1	physical	20211142
TLE6_MOUSE	Tle6	physical	20211142
NS1BP_MOUSE	Ivns1abp	physical	20211142
RBM39_MOUSE	Rbm39	physical	20211142

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CITE4_MOUSE

Related Literatures of Post-Translational Modification