UniProt ID | ZDHC6_MOUSE | |
---|---|---|
UniProt AC | Q9CPV7 | |
Protein Name | Palmitoyltransferase ZDHHC6 {ECO:0000305} | |
Gene Name | Zdhhc6 {ECO:0000312|MGI:MGI:1914230} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 413 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . When not palmitoylated, accumulates to dot-like structures in the endoplasmic reticulum. |
|
Protein Description | Endoplasmic reticulum palmitoyl acyltransferase that mediates palmitoylation of proteins such as AMFR, CALX, ITPR1 and TFRC. [PubMed: 25368151 Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins (By similarity Mediates palmitoylation of AMFR, promoting AMFR distribution to the peripheral endoplasmic reticulum (By similarity Together with SELENOK, palmitoylates ITPR1 in immune cells, leading to regulate ITPR1 stability and function] | |
Protein Sequence | MGIFCSVIKFENLQDLRRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMILYNYFNAMFAGPGFVPRGWKPEKSQDSMYLQYCKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASFTLFLLLAPLGCTHAAFIFVMTMYTQLYNRLSFGWNTVKIDMSAARRDPPPIVPFGLAAFAATLFALGLALGTTIAVGMLFFIQIKIILRNKTSIESWIEEKAKDRIQYYQLDEVFIFPYDMGSKWKNFKQVFTWSGVPEGDGLEWPIREGCDQYSLTIEQLKQKADKRVRSVRYKVIEDYNGACCPLNRGVRTFFTSPCTEEPRIRLQKGEFILATRGLRYWLYGDKILDDSFIEGTSRVRGWFPRNCVEKCPCDGDSDPAPEGEKKNR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
165 | Phosphorylation | AAFIFVMTMYTQLYN HHHHHHHHHHHHHHH | 11.17 | - | |
235 | Acetylation | IKIILRNKTSIESWI HHHHHCCCCCHHHHH | 36.90 | 7714461 | |
245 | Acetylation | IESWIEEKAKDRIQY HHHHHHHHHHHHCEE | 48.20 | 7714471 | |
328 | S-palmitoylation | IEDYNGACCPLNRGV EECCCCCEECCCCCC | 2.32 | 28826475 | |
329 | S-palmitoylation | EDYNGACCPLNRGVR ECCCCCEECCCCCCC | 4.21 | 28826475 | |
343 | S-palmitoylation | RTFFTSPCTEEPRIR CEEEECCCCCCCEEE | 8.18 | 28826475 | |
376 | Phosphorylation | GDKILDDSFIEGTSR CCEECCCCCCCCCCC | 27.99 | 28066266 | |
381 | Phosphorylation | DDSFIEGTSRVRGWF CCCCCCCCCCCCCCC | 10.69 | 28066266 | |
382 | Phosphorylation | DSFIEGTSRVRGWFP CCCCCCCCCCCCCCC | 39.37 | 28066266 | |
402 | Phosphorylation | KCPCDGDSDPAPEGE CCCCCCCCCCCCCCC | 51.53 | 30635358 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZDHC6_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
328 | C | Palmitoylation |
| 28826475 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZDHC6_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SSBP3_MOUSE | Ssbp3 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...