UniProt ID | CINP_HUMAN | |
---|---|---|
UniProt AC | Q9BW66 | |
Protein Name | Cyclin-dependent kinase 2-interacting protein | |
Gene Name | CINP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 212 | |
Subcellular Localization | Nucleus . Binds to nuclear under G1 conditions, and dissociates from chromatin with the start of DNA replication. | |
Protein Description | Interacts with the components of the replication complex and 2 kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication. Regulates ATR-mediated checkpoint signaling.. | |
Protein Sequence | MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEAKTLGT -------CCCCCCCC | 11.59 | 22814378 | |
4 | Ubiquitination | ----MEAKTLGTVTP ----CCCCCCCCCCC | 30.86 | - | |
8 | Phosphorylation | MEAKTLGTVTPRKPV CCCCCCCCCCCCCCE | 25.07 | 21815630 | |
10 | Phosphorylation | AKTLGTVTPRKPVLS CCCCCCCCCCCCEEE | 19.74 | 22617229 | |
13 | Ubiquitination | LGTVTPRKPVLSVSA CCCCCCCCCEEEEEE | 40.45 | - | |
24 | Ubiquitination | SVSARKIKDNAADWH EEEEEEHHCCHHHHH | 48.22 | - | |
39 | Phosphorylation | NLILKWETLNDAGFT HHEEEEEECCCCCCC | 29.73 | 20068231 | |
46 | Phosphorylation | TLNDAGFTTANNIAN ECCCCCCCCHHHHHH | 24.87 | 20068231 | |
47 | Phosphorylation | LNDAGFTTANNIANL CCCCCCCCHHHHHHC | 25.73 | 20068231 | |
57 | Phosphorylation | NIANLKISLLNKDKI HHHHCEEEECCCCCE | 25.80 | 24719451 | |
61 | Acetylation | LKISLLNKDKIELDS CEEEECCCCCEECCC | 61.44 | 12432655 | |
61 | Ubiquitination | LKISLLNKDKIELDS CEEEECCCCCEECCC | 61.44 | - | |
63 | Methylation | ISLLNKDKIELDSSS EEECCCCCEECCCCC | 39.42 | - | |
63 | Ubiquitination | ISLLNKDKIELDSSS EEECCCCCEECCCCC | 39.42 | - | |
68 | Phosphorylation | KDKIELDSSSPASKE CCCEECCCCCCCCCC | 45.39 | 25159151 | |
69 | Phosphorylation | DKIELDSSSPASKEN CCEECCCCCCCCCCC | 39.75 | 25159151 | |
70 | Phosphorylation | KIELDSSSPASKENE CEECCCCCCCCCCCH | 28.56 | 25159151 | |
73 | Phosphorylation | LDSSSPASKENEEKV CCCCCCCCCCCHHHH | 43.84 | 28450419 | |
117 | Ubiquitination | EKLSSTTKGICELEN HHHCCCCCCCEEECC | 46.49 | - | |
163 | Ubiquitination | YRKELLLKRTVAKEL HHHHHHHHHHHHHHH | 46.09 | - | |
173 | Phosphorylation | VAKELAHTGDPDLTL HHHHHHHHCCCCHHH | 37.36 | 22210691 | |
202 | Phosphorylation | DSRLHLESMLLETGH CCHHHHHHHHHHCCC | 22.53 | 22210691 | |
207 | Phosphorylation | LESMLLETGHRAL-- HHHHHHHCCCCCC-- | 37.95 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CINP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CINP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CINP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
ATRIP_HUMAN | ATRIP | physical | 19889979 | |
CA109_HUMAN | C1orf109 | physical | 25416956 | |
ATRIP_HUMAN | ATRIP | physical | 25416956 | |
FBF1_HUMAN | FBF1 | physical | 25416956 | |
SYCE1_HUMAN | SYCE1 | physical | 25416956 | |
SPA5L_HUMAN | SPATA5L1 | physical | 28514442 | |
CA109_HUMAN | C1orf109 | physical | 28514442 | |
KIF7_HUMAN | KIF7 | physical | 28514442 | |
POTEE_HUMAN | POTEE | physical | 28514442 | |
SPAT5_HUMAN | SPATA5 | physical | 28514442 | |
HECD1_HUMAN | HECTD1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-70, AND MASSSPECTROMETRY. |