dbPTM

AB16G_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AB16G_ARATH
UniProt AC	Q9M2V7
Protein Name	ABC transporter G family member 16
Gene Name	ABCG16
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	736
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description
Protein Sequence	MSRILVEDDNATPFHSMEIISSSLTLGQLLKNVSDVRKVEVGDETPVHEFFDRDGSSLDGDNDHLMRPVPFVLSFNNLTYNVSVRRKLDFHDLVPWRRTSFSKTKTLLDNISGETRDGEILAVLGASGSGKSTLIDALANRIAKGSLKGTVTLNGEALQSRMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRLPRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDEGHRGISGGERRRVSIGIDIIHDPIVLFLDEPTSGLDSTSAFMVVKVLKRIAESGSIIIMSIHQPSHRVLSLLDRLIFLSRGHTVFSGSPASLPSFFAGFGNPIPENENQTEFALDLIRELEGSAGGTRGLVEFNKKWQEMKKQSNPQTLTPPASPNPNLTLKEAISASISRGKLVSGGGGGSSVINHGGGTLAVPAFANPFWIEIKTLTRRSILNSRRQPELLGMRLATVIVTGFILATVFWRLDNSPKGVQERLGFFAFAMSTMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSLAFAVTTFWAVGLEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQLFDNSPLGELTYGMKLRLLDSVSRSIGMRISSSTCLTTGADVLKQQGVTQLSKWNCLLITVGFGFLFRILFYLCLLLGSKNKRR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
129	Phosphorylation	AVLGASGSGKSTLID EEEECCCCCHHHHHH	40.32	24243849
418	Phosphorylation	VINHGGGTLAVPAFA CEECCCCCEEEECCC	18.15	25368622

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AB16G_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AB16G_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AB16G_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUC3_ARATH	SUT2	physical	22737156
PRA1C_ARATH	PRA1.C	physical	24833385
PPT2_ARATH	PPT2	physical	24833385
HHP2_ARATH	HHP2	physical	24833385
HHP4_ARATH	HHP4	physical	24833385
UBC34_ARATH	UBC34	physical	24833385
UBC32_ARATH	UBC32	physical	24833385
ACBP6_ARATH	ACBP6	physical	24833385
PIP13_ARATH	PIP1C	physical	24833385
ELIP2_ARATH	ELIP2	physical	24833385
AB12I_ARATH	AT3G21580	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385
PPA3_ARATH	PAP3	physical	24833385
WAK3_ARATH	WAK3	physical	24833385
BETL2_ARATH	AT1G29060	physical	24833385
TBL18_ARATH	TBL18	physical	24833385
TRXH7_ARATH	TH7	physical	24833385

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AB16G_ARATH

Related Literatures of Post-Translational Modification