PRA1C_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PRA1C_ARATH
• UniProt AC: Q1G3K7
• Protein Name: PRA1 family protein C
• Gene Name: PRA1C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 127
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments..
• Protein Sequence: MIFRTNYIVIFIVSIFISMLWQPVHLSVFVILIVAWLYVYSRDNEPWVIFGSVIDDSTLVLVLLVLTIGIFLLTDVSRGIVIGVLAGLPVVLVHGMCRRNTEMLFVLEDDEEKVAMNTSSSSLSSSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PRA1C_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PRA1C_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PRA1C_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PRA1C_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LHTL8_ARATH	AT1G47670	physical	24833385
AB16G_ARATH	AT3G55090	physical	24833385
AB20G_ARATH	AT3G53510	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.