dbPTM

ELIP2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ELIP2_ARATH
UniProt AC	Q94K66
Protein Name	Early light-induced protein 2, chloroplastic {ECO:0000305}
Gene Name	ELIP2 {ECO:0000303\|PubMed:11473579}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	193
Subcellular Localization	Plastid, chloroplast thylakoid membrane Multi-pass membrane protein . Associated with both photosystems I and II (By similarity). Coisolates equally with monomeric (mLhcb) and trimeric (tLhcb) populations of the major LHC from photosystem II (PSII)
Protein Description	Probably involved in the integration of pigments into the mature light-harvesting pigment-protein complexes. Light-harvesting chlorophyll (LHC) a/b-binding protein required to ensure a high rate of chlorophyll accumulation during deetiolation in continuous high light. Involved in seed germination. May fulfill a photoprotective functions. Prevents excess accumulation of free chlorophyll by inhibiting the entire chlorophyll biosynthesis pathway (e.g. 5-aminolevulinate synthesis and Mg-protoporphyrin IX chelatase activity), and hence prevent photooxidative stress..
Protein Sequence	MATASFNMQSVFAAPSGVLTTRNIRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSATPPQMPQSPPPPVSKPKVSTKFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVALAFTEYVTGGTLV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ELIP2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ELIP2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ELIP2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ELIP2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ELIP2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ELIP2_ARATH

Related Literatures of Post-Translational Modification