UniProt ID | ZMAT5_HUMAN | |
---|---|---|
UniProt AC | Q9UDW3 | |
Protein Name | Zinc finger matrin-type protein 5 | |
Gene Name | ZMAT5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 170 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Ubiquitination | DNLHNRKKHLNGLQH HCCHHHHHHHCHHHH | 50.52 | - | |
32 | Acetylation | LNGLQHLKAKKVWYD HCHHHHHHHHHHHHH | 56.91 | 30586365 | |
32 | Ubiquitination | LNGLQHLKAKKVWYD HCHHHHHHHHHHHHH | 56.91 | - | |
34 | Acetylation | GLQHLKAKKVWYDMF HHHHHHHHHHHHHHH | 46.39 | 30586371 | |
122 | Phosphorylation | EKRAKRLSSAPSSRA HHHHHHHHCCCCCCC | 28.61 | 29083192 | |
123 | Phosphorylation | KRAKRLSSAPSSRAE HHHHHHHCCCCCCCC | 49.11 | 27282143 | |
126 | Phosphorylation | KRLSSAPSSRAEPIR HHHHCCCCCCCCCCE | 31.97 | 27282143 | |
127 | Phosphorylation | RLSSAPSSRAEPIRT HHHCCCCCCCCCCEE | 34.16 | 29083192 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZMAT5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZMAT5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZMAT5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DEN4B_HUMAN | DENND4B | physical | 28514442 | |
ZCRB1_HUMAN | ZCRB1 | physical | 28514442 | |
PDCD7_HUMAN | PDCD7 | physical | 28514442 | |
RBM40_HUMAN | RNPC3 | physical | 28514442 | |
SNR48_HUMAN | SNRNP48 | physical | 28514442 | |
ACTA_HUMAN | ACTA2 | physical | 28514442 | |
PSMG4_HUMAN | PSMG4 | physical | 28514442 | |
PSMG3_HUMAN | PSMG3 | physical | 28514442 | |
ACTBL_HUMAN | ACTBL2 | physical | 28514442 | |
CTU2_HUMAN | CTU2 | physical | 28514442 | |
PSME3_HUMAN | PSME3 | physical | 28514442 | |
GSTT1_HUMAN | GSTT1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...