| UniProt ID | ZHD11_ARATH | |
|---|---|---|
| UniProt AC | Q9SEZ1 | |
| Protein Name | Zinc-finger homeodomain protein 11 | |
| Gene Name | ZHD11 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 242 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription factor involved in the up-regulation of several stress-inducible genes. Acts as a transcriptional activator by interacting with MED25 and NAC proteins. Involved in increased drought tolerance.. | |
| Protein Sequence | MDLSSKPQQQLLNSLPIAGELTVTGEMGVCYKECLKNHAANLGGHALDGCGEFMPSPTATSTDPSSLRCAACGCHRNFHRRDPSENLNFLTAPPISSPSGTESPPSRHVSSPVPCSYYTSAPPHHVILSLSSGFPGPSDQDPTVVRSENSSRGAMRKRTRTKFTPEQKIKMRAFAEKAGWKINGCDEKSVREFCNEVGIERGVLKVWMHNNKYSLLNGKIREIEHGLCLNTHSNDGDGSSSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 91 | Phosphorylation | SENLNFLTAPPISSP CCCCCEEECCCCCCC | 30407730 | ||
| 96 | Phosphorylation | FLTAPPISSPSGTES EEECCCCCCCCCCCC | 30407730 | ||
| 97 | Phosphorylation | LTAPPISSPSGTESP EECCCCCCCCCCCCC | 30407730 | ||
| 99 | Phosphorylation | APPISSPSGTESPPS CCCCCCCCCCCCCCC | 30407730 | ||
| 101 | Phosphorylation | PISSPSGTESPPSRH CCCCCCCCCCCCCCC | 30407730 | ||
| 103 | Phosphorylation | SSPSGTESPPSRHVS CCCCCCCCCCCCCCC | 30407730 | ||
| 106 | Phosphorylation | SGTESPPSRHVSSPV CCCCCCCCCCCCCCC | 30407730 | ||
| 241 | Phosphorylation | NDGDGSSSS------ CCCCCCCCC------ | 27531888 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZHD11_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZHD11_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZHD11_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ZHD3_ARATH | HB21 | physical | 16428600 | |
| ATB22_ARATH | HB22 | physical | 16428600 | |
| ATB23_ARATH | AtHB23 | physical | 16428600 | |
| ZHD6_ARATH | HB24 | physical | 16428600 | |
| ZHD1_ARATH | HB25 | physical | 16428600 | |
| ZHD12_ARATH | HB26 | physical | 16428600 | |
| ZHD13_ARATH | HB27 | physical | 16428600 | |
| ZHD7_ARATH | HB28 | physical | 16428600 | |
| ZHD11_ARATH | ZFHD1 | physical | 16428600 | |
| ZHD8_ARATH | HB30 | physical | 16428600 | |
| ZHD4_ARATH | HB31 | physical | 16428600 | |
| ZHD5_ARATH | HB33 | physical | 16428600 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
