ATB22_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATB22_ARATH
• UniProt AC: Q4PSR7
• Protein Name: Homeobox-leucine zipper protein ATHB-22
• Gene Name: ATHB-22
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 185
• Subcellular Localization: Nucleus .
• Protein Description: Probable transcription factor..
• Protein Sequence: MEYWSSSFIDGASSSSFISPFYNFDHFSGNQDNRCLGTMMGAQQDILHVPLAMVESGYGEESNSFNGQEKKKKKMTSEQLKFLERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQIAVWFQNRKARWKNKQLEHLYESLRQEFDIVSREKELLQEELIQLKSMIREDSSCKKKQTWEKACS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	Phosphorylation	PDRKMKLSKELGLQP HHHHHHHHHHHCCCH	20.68	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATB22_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATB22_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATB22_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZHD3_ARATH	HB21	physical	16428600
ATB22_ARATH	HB22	physical	16428600
ATB23_ARATH	AtHB23	physical	16428600
ZHD6_ARATH	HB24	physical	16428600
ZHD1_ARATH	HB25	physical	16428600
ZHD7_ARATH	HB28	physical	16428600
ZHD11_ARATH	ZFHD1	physical	16428600
ZHD8_ARATH	HB30	physical	16428600

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.