ATB23_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATB23_ARATH
• UniProt AC: Q8LFD3
• Protein Name: Homeobox-leucine zipper protein ATHB-23
• Gene Name: ATHB-23
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 255
• Subcellular Localization: Nucleus .
• Protein Description: Probable transcription factor..
• Protein Sequence: MSCNNNGLAFFPENFSLQNHHQEEEDHPQLLQDFHGFLGKRSPMNNVQGFCNLDMNGDEEYSDDGSKMGEKKRRLNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRARSKTKQLEKDYDMLKRQFESLRDENEVLQTQNQKLQAQVMALKSREPIESINLNKETEGSCSDRSENISGDIRPPEIDSQFALGHPPTTTTMQFFQNSSSEQRMVKEENSISNMFCGIDDQSGFWPWLDQQQYN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ATB23_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATB23_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATB23_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATB23_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ZHD3_ARATH	HB21	physical	16428600
ATB22_ARATH	HB22	physical	16428600
ATB23_ARATH	AtHB23	physical	16428600
ZHD6_ARATH	HB24	physical	16428600
ZHD1_ARATH	HB25	physical	16428600
ZHD7_ARATH	HB28	physical	16428600
ZHD11_ARATH	ZFHD1	physical	16428600
ZHD8_ARATH	HB30	physical	16428600

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.