UniProt ID | ZHD6_ARATH | |
---|---|---|
UniProt AC | Q9ZPW7 | |
Protein Name | Zinc-finger homeodomain protein 6 | |
Gene Name | ZHD6 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 262 | |
Subcellular Localization | Nucleus. Interactions with MIF proteins prevent nuclear subcellular location and leads to a scattered repartition throughout the cytoplasm.. | |
Protein Description | Putative transcription factor.. | |
Protein Sequence | MEVREKKDEKMEMTRRKSSALDHHRLPPYTYSQTANKEKPTTKRNGSDPDPDPDLDTNPISISHAPRSYARPQTTSPGKARYRECQKNHAASSGGHVVDGCGEFMSSGEEGTVESLLCAACDCHRSFHRKEIDGLFVVNFNSFGHSQRPLGSRHVSPIMMSFGGGGGCAAESSTEDLNKFHQSFSGYGVDQFHHYQPKKRFRTKFNEEQKEKMMEFAEKIGWRMTKLEDDEVNRFCREIKVKRQVFKVWMHNNKQAAKKKDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
74 | Phosphorylation | RSYARPQTTSPGKAR HHCCCCCCCCCCCHH | 25561503 | ||
75 | Phosphorylation | SYARPQTTSPGKARY HCCCCCCCCCCCHHH | 25561503 | ||
76 | Phosphorylation | YARPQTTSPGKARYR CCCCCCCCCCCHHHH | 27545962 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZHD6_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZHD6_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZHD6_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATB22_ARATH | HB22 | physical | 16428600 | |
ATB23_ARATH | AtHB23 | physical | 16428600 | |
ZHD11_ARATH | ZFHD1 | physical | 16428600 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...