| UniProt ID | ZHD4_ARATH | |
|---|---|---|
| UniProt AC | Q9M9S0 | |
| Protein Name | Zinc-finger homeodomain protein 4 | |
| Gene Name | ZHD4 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 312 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Putative transcription factor. Probably involved in the regulation of floral induction.. | |
| Protein Sequence | MEIASQEDHDMPIPLNTTFGGGGSHGHMIHHHDHHAANSAPPTHNNNNTTQPPPMPLHGNGHGNNYDHHHHQDPHHVGYNAIIKKPMIKYKECLKNHAAAMGGNATDGCGEFMPSGEDGSIEALTCSACNCHRNFHRKEVEGELAATAMSPYHQHPPHRKLMLNHQKIRSAMPHQMIMPIGVSNYRYMHNNSESEDFMEEDGVTTASRSLPNLPYNQKKRFRTKFTPEQKEKMLSFAEKVGWKIQRQEDCVVQRFCEEIGVKRRVLKVWMHNNKIHFSKKNNINLEDNDNEKINNLNNVDLSGNNDMTKIVP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 150 | Phosphorylation | ELAATAMSPYHQHPP HHHHHHCCCCHHCCC | 27531888 | ||
| 187 | Phosphorylation | IGVSNYRYMHNNSES ECCCCCEECCCCCCC | 23776212 | ||
| 192 | Phosphorylation | YRYMHNNSESEDFME CEECCCCCCCCCHHH | 23776212 | ||
| 194 | Phosphorylation | YMHNNSESEDFMEED ECCCCCCCCCHHHHC | 23776212 | ||
| 302 | Phosphorylation | NLNNVDLSGNNDMTK CCCCEECCCCCCCCC | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZHD4_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZHD4_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZHD4_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ATB22_ARATH | HB22 | physical | 16428600 | |
| ZHD1_ARATH | HB25 | physical | 16428600 | |
| ZHD7_ARATH | HB28 | physical | 16428600 | |
| ZHD11_ARATH | ZFHD1 | physical | 16428600 | |
| ZHD5_ARATH | HB33 | physical | 16428600 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...