| UniProt ID | ZHD12_ARATH | |
|---|---|---|
| UniProt AC | Q9FKJ9 | |
| Protein Name | Zinc-finger homeodomain protein 12 | |
| Gene Name | ZHD12 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 223 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Putative transcription factor.. | |
| Protein Sequence | MSSLSKPNRQFLSPTTNNQDTGREQTIACARDMVVLYNECLKNHAVSLGGHALDGCGEFTPKSTTILTDPPSLRCDACGCHRNFHRRSPSDGFSQHRSPPSPLQLQPLAPVPNLLLSLSSGFFGPSDQEVKNKFTVERDVRKTAMIKKHKRTKFTAEQKVKMRGFAERAGWKINGWDEKWVREFCSEVGIERKVLKVWIHNNKYFNNGRSRDTTSSMSLNLKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 210 | Phosphorylation | KYFNNGRSRDTTSSM CCCCCCCCCCCCCCC | 19880383 | ||
| 213 | Phosphorylation | NNGRSRDTTSSMSLN CCCCCCCCCCCCEEE | 19880383 | ||
| 214 | Phosphorylation | NGRSRDTTSSMSLNL CCCCCCCCCCCEEEC | 19880383 | ||
| 215 | Phosphorylation | GRSRDTTSSMSLNLK CCCCCCCCCCEEECC | 19880383 | ||
| 216 | Phosphorylation | RSRDTTSSMSLNLKL CCCCCCCCCEEECCC | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZHD12_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZHD12_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZHD12_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZHD12_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...