YNB9_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YNB9_YEAST
• UniProt AC: P53975
• Protein Name: Uncharacterized membrane protein YNL019C
• Gene Name: YNL019C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 284
• Subcellular Localization: Cell membrane; Single-pass membrane protein.
• Protein Sequence: MLYSRESRTTVLFLALVTSLTVLCHSVDVTTVFTTSTITEITTVTAAPQPQNKAETALNTATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEKMVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLSTEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLGGITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
270	N-linked_Glycosylation	VLSRDRPNQTLLSVH EEECCCCCCEEEEEE	48.65	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YNB9_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YNB9_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YNB9_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TECR_YEAST	TSC13	genetic	27708008
TAF12_YEAST	TAF12	genetic	27708008
RPB7_YEAST	RPB7	genetic	27708008
TBP_YEAST	SPT15	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
BRL1_YEAST	BRL1	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
ARP4_YEAST	ARP4	genetic	27708008
FIP1_YEAST	FIP1	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.