UniProt ID | YNB9_YEAST | |
---|---|---|
UniProt AC | P53975 | |
Protein Name | Uncharacterized membrane protein YNL019C | |
Gene Name | YNL019C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 284 | |
Subcellular Localization |
Cell membrane Single-pass membrane protein. |
|
Protein Description | ||
Protein Sequence | MLYSRESRTTVLFLALVTSLTVLCHSVDVTTVFTTSTITEITTVTAAPQPQNKAETALNTATNIIQTMQFLFNCAPFKWKGPLKITSCALNFIVLLLTAWGYLLKYLQENKLNSDADMEKMVGLGFGEMVGRIFGKGVGKAFTKMDITQKLVYPFEGSNRQKCLLMTVGENSIVPFHDLSTEICFDQYTLDSLSHHNHGSISILDAGSVSALGFADISSKMPSVSELYTLFGDYTIEVLGGITKLASTLNREDWQGERNGFAVLSRDRPNQTLLSVHMYSSSLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
270 | N-linked_Glycosylation | VLSRDRPNQTLLSVH EEECCCCCCEEEEEE | 48.65 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YNB9_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YNB9_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YNB9_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TECR_YEAST | TSC13 | genetic | 27708008 | |
TAF12_YEAST | TAF12 | genetic | 27708008 | |
RPB7_YEAST | RPB7 | genetic | 27708008 | |
TBP_YEAST | SPT15 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
BRL1_YEAST | BRL1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
ARP4_YEAST | ARP4 | genetic | 27708008 | |
FIP1_YEAST | FIP1 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...