UniProt ID | YM272_YEAST | |
---|---|---|
UniProt AC | Q8TGS5 | |
Protein Name | Uncharacterized protein YMR272W-B | |
Gene Name | YMR272W-B | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 35 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRSLVFVQLSLLSWEIFCGERSFVSMKAIFSCMYV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YM272_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YM272_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YM272_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YM272_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YRA2_YEAST | YRA2 | genetic | 27708008 | |
RPB1_YEAST | RPO21 | genetic | 27708008 | |
SEC5_YEAST | SEC5 | genetic | 27708008 | |
GPI19_YEAST | GPI19 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
NUP57_YEAST | NUP57 | genetic | 27708008 | |
GPI16_YEAST | GPI16 | genetic | 27708008 | |
PRS7_YEAST | RPT1 | genetic | 27708008 | |
NEP1_YEAST | EMG1 | genetic | 27708008 | |
ESA1_YEAST | ESA1 | genetic | 27708008 | |
ULP1_YEAST | ULP1 | genetic | 27708008 | |
BUR1_YEAST | SGV1 | genetic | 27708008 | |
SEC23_YEAST | SEC23 | genetic | 27708008 | |
THRC_YEAST | THR4 | genetic | 27708008 | |
SLX5_YEAST | SLX5 | genetic | 27708008 | |
RS29B_YEAST | RPS29B | genetic | 27708008 | |
CHO2_YEAST | CHO2 | genetic | 27708008 | |
ELM1_YEAST | ELM1 | genetic | 27708008 | |
UBI4P_YEAST | UBI4 | genetic | 27708008 | |
RL22A_YEAST | RPL22A | genetic | 27708008 | |
SIC1_YEAST | SIC1 | genetic | 27708008 | |
PEX13_YEAST | PEX13 | genetic | 27708008 | |
RNH2A_YEAST | RNH201 | genetic | 27708008 | |
NIP80_YEAST | NIP100 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...