dbPTM

YGN8_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YGN8_YEAST
UniProt AC	P53122
Protein Name	Uncharacterized protein YGL138C
Gene Name	YGL138C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	345
Subcellular Localization
Protein Description
Protein Sequence	MYNFLEFFFFFITYTLFKSTFVQGKSSFPGHDVCKFEDQNFQTEFFLNVLKGDKLQNLKQEYEQYKKQSTLYTGFVIEKQYEYQVAPLQINNFLQVTFCKGGKPIWNHILPFQKDLDWAEPLCIPAQEDDTISQNSSVCFKFARVQKYTQRNVTLYFPNKFVGFVFVCNSSKTHPPTQNNFETIPLTPIISDDIRDYKISWSIKGRITKVVPYLHSLSIPMSKYEMLIHSDKNISNELEYKSLTSEFWKSYKNLRKFKNKEMSWINEINPMEQYDSSGNENVPNFHEKLDRTINRIAQNIERPHDALIRAIAAHNRNSNSGNITRRKYLRRKISKMLKNKIPLKN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YGN8_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YGN8_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YGN8_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YGN8_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SYIC_YEAST	ILS1	genetic	27708008
UBC3_YEAST	CDC34	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
DPOD2_YEAST	POL31	genetic	27708008
TIM14_YEAST	PAM18	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YGN8_YEAST

Related Literatures of Post-Translational Modification