UniProt ID | YF041_YEAST | |
---|---|---|
UniProt AC | Q3E817 | |
Protein Name | Uncharacterized protein YFL041W-A | |
Gene Name | YFL041W-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 63 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKMWGPSQRDSFREITYKVKFKYDDGDYSLAIDLMSRDCINVYELITDRLLVDFLSKKLLKLR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YF041_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YF041_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YF041_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YF041_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GRC3_YEAST | GRC3 | genetic | 27708008 | |
ORC2_YEAST | ORC2 | genetic | 27708008 | |
TIM22_YEAST | TIM22 | genetic | 27708008 | |
MAK21_YEAST | MAK21 | genetic | 27708008 | |
PRP3_YEAST | PRP3 | genetic | 27708008 | |
RBA50_YEAST | RBA50 | genetic | 27708008 | |
KOG1_YEAST | KOG1 | genetic | 27708008 | |
HSP77_YEAST | SSC1 | genetic | 27708008 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
SSL1_YEAST | SSL1 | genetic | 27708008 | |
SEC65_YEAST | SEC65 | genetic | 27708008 | |
RSC9_YEAST | RSC9 | genetic | 27708008 | |
ERB1_YEAST | ERB1 | genetic | 27708008 | |
LCB1_YEAST | LCB1 | genetic | 27708008 | |
PROF_YEAST | PFY1 | genetic | 27708008 | |
PSB5_YEAST | PRE2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...