| UniProt ID | YF041_YEAST | |
|---|---|---|
| UniProt AC | Q3E817 | |
| Protein Name | Uncharacterized protein YFL041W-A | |
| Gene Name | YFL041W-A | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 63 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MKMWGPSQRDSFREITYKVKFKYDDGDYSLAIDLMSRDCINVYELITDRLLVDFLSKKLLKLR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YF041_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YF041_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YF041_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YF041_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GRC3_YEAST | GRC3 | genetic | 27708008 | |
| ORC2_YEAST | ORC2 | genetic | 27708008 | |
| TIM22_YEAST | TIM22 | genetic | 27708008 | |
| MAK21_YEAST | MAK21 | genetic | 27708008 | |
| PRP3_YEAST | PRP3 | genetic | 27708008 | |
| RBA50_YEAST | RBA50 | genetic | 27708008 | |
| KOG1_YEAST | KOG1 | genetic | 27708008 | |
| HSP77_YEAST | SSC1 | genetic | 27708008 | |
| CDC11_YEAST | CDC11 | genetic | 27708008 | |
| SSL1_YEAST | SSL1 | genetic | 27708008 | |
| SEC65_YEAST | SEC65 | genetic | 27708008 | |
| RSC9_YEAST | RSC9 | genetic | 27708008 | |
| ERB1_YEAST | ERB1 | genetic | 27708008 | |
| LCB1_YEAST | LCB1 | genetic | 27708008 | |
| PROF_YEAST | PFY1 | genetic | 27708008 | |
| PSB5_YEAST | PRE2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...