UniProt ID | YEI3_YEAST | |
---|---|---|
UniProt AC | P39974 | |
Protein Name | Uncharacterized protein YEL073C | |
Gene Name | YEL073C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 107 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVNLANVLTNATAATLSAWSNTVPLETYFHFDEASGFGDYYLNVSVIWMNETLYETRIVPAIINVREWLDHMEANDPSPSVTNPYETSGYYAFSTVVPVLMGNMKVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YEI3_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YEI3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YEI3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YEI3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MOB2_YEAST | MOB2 | genetic | 27708008 | |
DPOA2_YEAST | POL12 | genetic | 27708008 | |
ORC2_YEAST | ORC2 | genetic | 27708008 | |
MED8_YEAST | MED8 | genetic | 27708008 | |
ENP1_YEAST | ENP1 | genetic | 27708008 | |
TECR_YEAST | TSC13 | genetic | 27708008 | |
TAF12_YEAST | TAF12 | genetic | 27708008 | |
TRS23_YEAST | TRS23 | genetic | 27708008 | |
TFC6_YEAST | TFC6 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
KRE9_YEAST | KRE9 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
LIP1_YEAST | LIP1 | genetic | 27708008 | |
NOP2_YEAST | NOP2 | genetic | 27708008 | |
TYSY_YEAST | CDC21 | genetic | 27708008 | |
SMP3_YEAST | SMP3 | genetic | 27708008 | |
APC5_YEAST | APC5 | genetic | 27708008 | |
SEC63_YEAST | SEC63 | genetic | 27708008 | |
DIB1_YEAST | DIB1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...