| UniProt ID | YEI3_YEAST | |
|---|---|---|
| UniProt AC | P39974 | |
| Protein Name | Uncharacterized protein YEL073C | |
| Gene Name | YEL073C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 107 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MVNLANVLTNATAATLSAWSNTVPLETYFHFDEASGFGDYYLNVSVIWMNETLYETRIVPAIINVREWLDHMEANDPSPSVTNPYETSGYYAFSTVVPVLMGNMKVA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YEI3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YEI3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YEI3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YEI3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| DPOA2_YEAST | POL12 | genetic | 27708008 | |
| ORC2_YEAST | ORC2 | genetic | 27708008 | |
| MED8_YEAST | MED8 | genetic | 27708008 | |
| ENP1_YEAST | ENP1 | genetic | 27708008 | |
| TECR_YEAST | TSC13 | genetic | 27708008 | |
| TAF12_YEAST | TAF12 | genetic | 27708008 | |
| TRS23_YEAST | TRS23 | genetic | 27708008 | |
| TFC6_YEAST | TFC6 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| KRE9_YEAST | KRE9 | genetic | 27708008 | |
| KTHY_YEAST | CDC8 | genetic | 27708008 | |
| LIP1_YEAST | LIP1 | genetic | 27708008 | |
| NOP2_YEAST | NOP2 | genetic | 27708008 | |
| TYSY_YEAST | CDC21 | genetic | 27708008 | |
| SMP3_YEAST | SMP3 | genetic | 27708008 | |
| APC5_YEAST | APC5 | genetic | 27708008 | |
| SEC63_YEAST | SEC63 | genetic | 27708008 | |
| DIB1_YEAST | DIB1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...