YD182_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YD182_YEAST
• UniProt AC: Q3E796
• Protein Name: Uncharacterized protein YDR182W-A
• Gene Name: YDR182W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 67
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MNKRYKLYRVWYYYAHQTVCITSTGFALCFVVQAKTAGLGVTPITSLYGDKKEHLGKLLVPLVLYQI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YD182_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YD182_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YD182_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YD182_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MAK5_YEAST	MAK5	genetic	27708008
TIM22_YEAST	TIM22	genetic	27708008
RPB7_YEAST	RPB7	genetic	27708008
NUP57_YEAST	NUP57	genetic	27708008
MED6_YEAST	MED6	genetic	27708008
FDFT_YEAST	ERG9	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
GSP1_YEAST	GSP1	genetic	27708008
ERB1_YEAST	ERB1	genetic	27708008
NOP2_YEAST	NOP2	genetic	27708008
SMP3_YEAST	SMP3	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.