YD159_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YD159_YEAST
• UniProt AC: Q3E774
• Protein Name: Uncharacterized protein YDL159W-A
• Gene Name: YDL159W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 43
• Protein Sequence: MYNQIINTFIDDCLFLQTPMLQSPISSKIVLSFFLRNFFPSLF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YD159_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YD159_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YD159_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YD159_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STU1_YEAST	STU1	genetic	27708008
CDC10_YEAST	CDC10	genetic	27708008
YIP1_YEAST	YIP1	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
BET3_YEAST	BET3	genetic	27708008
NMT_YEAST	NMT1	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
RNA1_YEAST	RNA1	genetic	27708008
NOP2_YEAST	NOP2	genetic	27708008
RPC6_YEAST	RPC34	genetic	27708008
BUR1_YEAST	SGV1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.