| UniProt ID | WRIP1_SCHPO | |
|---|---|---|
| UniProt AC | O13984 | |
| Protein Name | ATPase WRNIP1 homolog C26H5.02c | |
| Gene Name | SPAC26H5.02c | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 504 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Functions as a modulator for initiation or reinitiation events during DNA polymerase delta-mediated DNA synthesis. Has an intrinsic ATPase activity that functions as a sensor of DNA damage or of arrested replication forks and regulates the extent of DNA synthesis (By similarity).. | |
| Protein Sequence | MSGPDHVQCPVCAKTVTMNDINPHLDSHYSDSSGPSKPVSPFFKKERYKHHLETNVSSHQSATKFIEPEPSPTKKTKLTRRDTRPLAERARPKSLDEYVGQEELVGERGIIRNLIEQDRCNSMILWGSAGTGKTTLARLIAVTTKSRFIEISATSTTVADCRKIFEDSQNYLTLTGRKTIIFLDEVHRFNRAQQDIFLPMVEKGLVTLIGATTENPSFRLNSALISRCPVFVLKKLTRDNVKKILNHACLLESERLGSSMPNVETSIIDYISAITDGDARMALNALEMSIGMLRQGPLSLEDIKDKLVRSSALYDRVGDVHYDTISAFHKSVRGSDVDATLYYLGRMLESGEDPLYVARRMVRIASEDIGIADNSMLPLASSTFTAVQQVGMPEADVILAHCAVALALAPKSVDVYRSYNAVKSFLSSHPDAGRAEIPMHIRNAPTNLMKQLGYHKGYKYNPDYKDGLVMQEYLPDSIKGTKFYKLPIELKEDEEIKNLKTDTK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Phosphorylation | SGPSKPVSPFFKKER CCCCCCCCHHHCHHH | 25.23 | 24763107 | |
| 71 | Phosphorylation | KFIEPEPSPTKKTKL CCCCCCCCCCCCCCC | 43.47 | 24763107 | |
| 73 | Phosphorylation | IEPEPSPTKKTKLTR CCCCCCCCCCCCCCH | 49.89 | 29996109 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WRIP1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WRIP1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WRIP1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HIR1_SCHPO | hip1 | genetic | 18818364 | |
| RYH1_SCHPO | ryh1 | genetic | 22681890 | |
| YGVA_SCHPO | def1 | genetic | 22681890 | |
| WRIP1_SCHPO | SPAC26H5.02c | physical | 26771498 | |
| YF75_SCHPO | spa2 | physical | 26771498 | |
| YPP1_SCHPO | SPAC637.04 | physical | 26771498 | |
| MUG79_SCHPO | spo7 | physical | 26771498 | |
| YBB9_SCHPO | SPBC13G1.09 | physical | 26771498 | |
| RAN1_SCHPO | ran1 | physical | 26771498 | |
| GFH1_SCHPO | gfh1 | physical | 26771498 | |
| MCP5_SCHPO | mcp5 | physical | 26771498 | |
| LTN1_SCHPO | rkr1 | physical | 26771498 | |
| RPB4_SCHPO | rpb4 | physical | 26771498 | |
| SWD3_SCHPO | swd3 | physical | 26771498 | |
| YGV4_SCHPO | SPBC354.04 | physical | 26771498 | |
| AP1M1_SCHPO | apm1 | physical | 26771498 | |
| PRS10_SCHPO | rpt4 | physical | 26771498 | |
| PEF1_SCHPO | pef1 | physical | 26771498 | |
| SNF1_SCHPO | ssp2 | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
