UniProt ID | WRIP1_SCHPO | |
---|---|---|
UniProt AC | O13984 | |
Protein Name | ATPase WRNIP1 homolog C26H5.02c | |
Gene Name | SPAC26H5.02c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 504 | |
Subcellular Localization | Nucleus . | |
Protein Description | Functions as a modulator for initiation or reinitiation events during DNA polymerase delta-mediated DNA synthesis. Has an intrinsic ATPase activity that functions as a sensor of DNA damage or of arrested replication forks and regulates the extent of DNA synthesis (By similarity).. | |
Protein Sequence | MSGPDHVQCPVCAKTVTMNDINPHLDSHYSDSSGPSKPVSPFFKKERYKHHLETNVSSHQSATKFIEPEPSPTKKTKLTRRDTRPLAERARPKSLDEYVGQEELVGERGIIRNLIEQDRCNSMILWGSAGTGKTTLARLIAVTTKSRFIEISATSTTVADCRKIFEDSQNYLTLTGRKTIIFLDEVHRFNRAQQDIFLPMVEKGLVTLIGATTENPSFRLNSALISRCPVFVLKKLTRDNVKKILNHACLLESERLGSSMPNVETSIIDYISAITDGDARMALNALEMSIGMLRQGPLSLEDIKDKLVRSSALYDRVGDVHYDTISAFHKSVRGSDVDATLYYLGRMLESGEDPLYVARRMVRIASEDIGIADNSMLPLASSTFTAVQQVGMPEADVILAHCAVALALAPKSVDVYRSYNAVKSFLSSHPDAGRAEIPMHIRNAPTNLMKQLGYHKGYKYNPDYKDGLVMQEYLPDSIKGTKFYKLPIELKEDEEIKNLKTDTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | SGPSKPVSPFFKKER CCCCCCCCHHHCHHH | 25.23 | 24763107 | |
71 | Phosphorylation | KFIEPEPSPTKKTKL CCCCCCCCCCCCCCC | 43.47 | 24763107 | |
73 | Phosphorylation | IEPEPSPTKKTKLTR CCCCCCCCCCCCCCH | 49.89 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WRIP1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WRIP1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WRIP1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HIR1_SCHPO | hip1 | genetic | 18818364 | |
RYH1_SCHPO | ryh1 | genetic | 22681890 | |
YGVA_SCHPO | def1 | genetic | 22681890 | |
WRIP1_SCHPO | SPAC26H5.02c | physical | 26771498 | |
YF75_SCHPO | spa2 | physical | 26771498 | |
YPP1_SCHPO | SPAC637.04 | physical | 26771498 | |
MUG79_SCHPO | spo7 | physical | 26771498 | |
YBB9_SCHPO | SPBC13G1.09 | physical | 26771498 | |
RAN1_SCHPO | ran1 | physical | 26771498 | |
GFH1_SCHPO | gfh1 | physical | 26771498 | |
MCP5_SCHPO | mcp5 | physical | 26771498 | |
LTN1_SCHPO | rkr1 | physical | 26771498 | |
RPB4_SCHPO | rpb4 | physical | 26771498 | |
SWD3_SCHPO | swd3 | physical | 26771498 | |
YGV4_SCHPO | SPBC354.04 | physical | 26771498 | |
AP1M1_SCHPO | apm1 | physical | 26771498 | |
PRS10_SCHPO | rpt4 | physical | 26771498 | |
PEF1_SCHPO | pef1 | physical | 26771498 | |
SNF1_SCHPO | ssp2 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...