UniProt ID | AP1M1_SCHPO | |
---|---|---|
UniProt AC | Q9HFE5 | |
Protein Name | AP-1 complex subunit mu-1 | |
Gene Name | apm1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 426 | |
Subcellular Localization |
Cytoplasmic vesicle, clathrin-coated vesicle membrane Peripheral membrane protein Cytoplasmic side. Membrane, clathrin-coated pit Peripheral membrane protein Cytoplasmic side. |
|
Protein Description | Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration (By similarity).. | |
Protein Sequence | MASAIFVLNLKGKVIISRDYRADIPMSVVEKFLPLKSEVEEEQGFSTPCLTHEGINYIYIHHNDVYLLALSKMNSDAMEMLVFLRKMADVFIDYFKELQEESIRDNFVLVYELLDEIMDFGFPQTTETKILQEYITQTSNTVKKHAPPPIAMTNAISWRSEGIHYRKNEVFLDVIESVNLIAAADGTVIQSEILGKVRLKCYLSGMPELRLGLNDKVLFEAAGRTIKGNTVEMEDVKFHQCVRLARFENDRTISFIPPDGEFDLMSYRMSSNVRPLIWVECESIVHSGSRIEFMVKAKAQFKKRCIANNVQIIIPVPEDADSPRFQTSNGHVQYAPEQAAMVWNIKKFAGGKEFFMRAEMGLPSVKNEDIQVQKKRPVQLKFAIPYFTTSGIQVRYLKITEPKLNYHAMPWVRYVTQNGTEYSIRQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
153 | Phosphorylation | APPPIAMTNAISWRS CCCCEEEECCCEECC | 16.69 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP1M1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP1M1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP1M1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RHO3_SCHPO | rho3 | genetic | 21304827 | |
RHO3_SCHPO | rho3 | physical | 21304827 | |
ECM33_SCHPO | ecm33 | genetic | 22848669 | |
YCD3_SCHPO | trp1322 | genetic | 22848669 | |
YB95_SCHPO | SPBC1E8.05 | genetic | 22848669 | |
PMP1_SCHPO | pmp1 | genetic | 22848669 | |
RHO3_SCHPO | rho3 | physical | 23840894 | |
RL401_SCHPO | ubi1 | genetic | 24454826 | |
RL402_SCHPO | ubi1 | genetic | 24454826 | |
UBC4_SCHPO | ubc4 | genetic | 24454826 | |
THI22_SCHPO | SPBP8B7.18c | physical | 26771498 | |
PIL1_SCHPO | pil1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...