YB95_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YB95_SCHPO
• UniProt AC: O42970
• Protein Name: Uncharacterized serine-rich protein C1E8.05
• Gene Name: SPBC1E8.05
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 317
• Protein Sequence: MKLSFILSTLVAGALAYNEFSAPGPNAVLQEGGGVNTVSWSNLTSSTVTLTLYRGGNSALTPIETIASDIDNTGTYLWNIATYYEAADDYLLGLSFDGGETYSQYFTLQACSTCTISTSSLSYSGTISSTSIAPSMIGTRTSSSYFITSSSSTPSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSSSSSKSSSSSSSSSKSSASPSSSKSSSKFSSSSFITSTTPASSSSSGAIVSNAKTASTDDSSSASSATSSVSSVVSSASSALSASASSASASVSSSASSDASPALKTGINALVAVGVVSAIALFL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
42	N-linked_Glycosylation	VNTVSWSNLTSSTVT CCEEECCCCCCCEEE	40.87	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YB95_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YB95_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YB95_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YB95_SCHPO	SPBC1E8.05	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.