UBC4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBC4_SCHPO
• UniProt AC: P46595
• Protein Name: Ubiquitin-conjugating enzyme E2 4
• Gene Name: ubc4
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 147
• Protein Description: Catalyzes the covalent attachment of ubiquitin to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. Mediates ubiquitination of PEX5..
• Protein Sequence: MALKRINRELADLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPYAGGVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of UBC4_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBC4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBC4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBC4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC11_SCHPO	ubc11	genetic	23442800
ASF1_SCHPO	cia1	genetic	21324894
PUB3_SCHPO	pub3	physical	26771498
YO45_SCHPO	SPBC36B7.05c	physical	26771498
MEU23_SCHPO	meu23	physical	26771498
UBA1_SCHPO	ptr3	physical	28572513

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.