UBC11_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBC11_SCHPO
• UniProt AC: O00103
• Protein Name: Ubiquitin-conjugating enzyme E2-20 kDa
• Gene Name: ubc11
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 176
• Protein Description: Catalyzes the covalent attachment of ubiquitin to other proteins..
• Protein Sequence: MDSDMQNQNPHTNSKNSSSAGMAVDGHSVTKRLRSELMSLMMSNTPGISAFPDSDSNLLHWAGTITGPSDTYYEGLKFKISMSFPANYPYSPPTIIFTSPMWHPNVDMSGNICLDILKDKWSAVYNVQTILLSLQSLLGEPNNASPLNAQAAELWSKDPIEYKRLLMQRYKEIDEI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	PHTNSKNSSSAGMAV CCCCCCCCCCCCCCC	29.43	21712547
18	Phosphorylation	HTNSKNSSSAGMAVD CCCCCCCCCCCCCCC	33.33	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBC11_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBC11_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBC11_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF73_SCHPO	taf73	genetic	11279037
TAF5_SCHPO	taf5	genetic	11279037
MAD2_SCHPO	mad2	genetic	23442800
SLP1_SCHPO	slp1	genetic	23442800
UBI4P_SCHPO	ubi4	physical	23442800

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.