UniProt ID | TXL1_SCHPO | |
---|---|---|
UniProt AC | Q9USR1 | |
Protein Name | Thioredoxin-like protein 1 | |
Gene Name | txl1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 290 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Has a role in cellular detoxification of alkyl hydroperoxide.. | |
Protein Sequence | MSVIEIRSYQHWISTIPKSGYLAVDCYADWCGPCKAISPLFSQLASKYASPKFVFAKVNVDEQRQIASGLGVKAMPTFVFFENGKQIDMLTGANPQALKEKVALISSKATGTGALASSSSAPVKGFASLQGCIENPQLECLNQQDDHDLKSAFNSNPSSFLESDVDEQLMIYIPFLEVVKVHSIAITPVKGETSSAPKTIKLYINQPNNLSFEDAESFTPTQVIEDIVYEQDDQPTIIPLRFVKFQRVNSLVIFIYSNVGEEETTKISRLELFGEPVGDSSKGKLQKVEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
280 | Phosphorylation | FGEPVGDSSKGKLQK CCCCCCCCCCCCCEE | 28.20 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TXL1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TXL1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TXL1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPN11_SCHPO | rpn11 | physical | 21091378 | |
RPN1_SCHPO | mts4 | physical | 21091378 | |
CUT8_SCHPO | cut8 | genetic | 21091378 | |
RYH1_SCHPO | ryh1 | genetic | 22681890 | |
GPD1_SCHPO | gpd1 | genetic | 22681890 | |
VAM7_SCHPO | SPCC594.06c | genetic | 22681890 | |
PDX1_SCHPO | snz1 | genetic | 22681890 | |
YF48_SCHPO | SPAC3H5.08c | genetic | 22681890 | |
PAM17_SCHPO | pam17 | genetic | 22681890 | |
YETB_SCHPO | fra2 | genetic | 22681890 | |
TR112_SCHPO | trm112 | genetic | 22681890 | |
MID1_SCHPO | mid1 | genetic | 22681890 | |
YETC_SCHPO | SPAC8C9.12c | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...