dbPTM

TNFB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TNFB_HUMAN
UniProt AC	P01374
Protein Name	Lymphotoxin-alpha
Gene Name	LTA
Organism	Homo sapiens (Human).
Sequence Length	205
Subcellular Localization	Secreted. Membrane. The homotrimer is secreted. The heterotrimer is membrane-associated.
Protein Description	Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo..
Protein Sequence	MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	FLPRVCGTTLHLLLL CHHCHHHHHHHHHHH	22.51	22210691
16	Phosphorylation	LPRVCGTTLHLLLLG HHCHHHHHHHHHHHH	9.47	22210691
41	O-linked_Glycosylation	GLPGVGLTPSAAQTA CCCCCCCCHHHHHHH	14.85	1451807
41	O-linked_Glycosylation	GLPGVGLTPSAAQTA CCCCCCCCHHHHHHH	14.85	8323280
96	N-linked_Glycosylation	QDGFSLSNNSLLVPT CCCCCCCCCCEEEEC	47.61	1451807
96	N-linked_Glycosylation	QDGFSLSNNSLLVPT CCCCCCCCCCEEEEC	47.61	8323280
120	Sulfoxidation	VVFSGKAYSPKATSS EEECCCCCCCCCCCC	29.05	27547920

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TNFB_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TNFB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TNFB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TNFC_HUMAN	LTB	physical	9235946
TNFC_HUMAN	LTB	physical	9317127
TNFC_HUMAN	LTB	physical	7995952
UROM_HUMAN	UMOD	physical	8323280
LEG2_HUMAN	LGALS2	physical	15129282
TBA1B_HUMAN	TUBA1B	physical	15129282
TNR1A_HUMAN	TNFRSF1A	physical	1310388
TNR1B_HUMAN	TNFRSF1B	physical	1310388
TNR1A_HUMAN	TNFRSF1A	physical	8182064
TNR1B_HUMAN	TNFRSF1B	physical	8182064
ANR40_HUMAN	ANKRD40	physical	28514442

Drug and Disease Associations

Kegg Disease
H00344	Leprosy; Hansen disease
OMIM Disease
607507	Psoriatic arthritis (PSORAS)
Kegg Drug
D00742	Etanercept (genetical recombination) (JAN); Etanercept (USAN/INN); Enbrel (TN)
D04690	Lenercept (USAN/INN)
D10187	Pateclizumab (USAN)
DrugBank
DB00005	Etanercept

Regulatory Network of TNFB_HUMAN

Related Literatures of Post-Translational Modification

N-linked Glycosylation
Reference	PubMed
"Natural human tumor necrosis factor beta (lymphotoxin). Variable O-glycosylation at Thr7, proteolytic processing, and allelicvariation."; Voigt C.G., Maurer-Fogy I., Adolf G.R.; FEBS Lett. 314:85-88(1992). Cited for: PARTIAL PROTEIN SEQUENCE, GLYCOSYLATION AT THR-41 AND ASN-96, ANDVARIANT ASN-60.	1451807 [Abstract]
O-linked Glycosylation
Reference	PubMed
"Natural human tumor necrosis factor beta (lymphotoxin). Variable O-glycosylation at Thr7, proteolytic processing, and allelicvariation."; Voigt C.G., Maurer-Fogy I., Adolf G.R.; FEBS Lett. 314:85-88(1992). Cited for: PARTIAL PROTEIN SEQUENCE, GLYCOSYLATION AT THR-41 AND ASN-96, ANDVARIANT ASN-60.	1451807 [Abstract]