UniProt ID | TM109_MOUSE | |
---|---|---|
UniProt AC | Q3UBX0 | |
Protein Name | Transmembrane protein 109 | |
Gene Name | Tmem109 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 243 | |
Subcellular Localization |
Nucleus outer membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein . Sarcoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | May mediate cellular response to DNA damage by protecting against ultraviolet C-induced cell death. [PubMed: 20060811 Can form voltage-gated calcium and potassium channels in vitro (By similarity] | |
Protein Sequence | MAGAHSTPLWSRHLLKAVLMVLVALFLVHSASAQSHREFASPGQQKKETSADILTQIGRSLKEMLDTWLGPETMHVISETLLQVMWAISSAISVACFALSGIAAQLLSALGLDGEQLTQGLKLSPSQVQTLLLWGAAALVIYWLLSLLLGLVLALLGRILGGLKLVLFVAGFVALVRSVPDPSTRALMLLALLTLFALLSRLTGSRSSGSHLEAKVRGLERQIEELRGRQRRAAKMPRSMEEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | QSHREFASPGQQKKE HHHHHHCCCCCCCCH | 34.58 | 28464351 | |
46 | Acetylation | FASPGQQKKETSADI HCCCCCCCCHHHHHH | 44.69 | 19846437 | |
49 | Phosphorylation | PGQQKKETSADILTQ CCCCCCHHHHHHHHH | 37.79 | 28542873 | |
50 | Phosphorylation | GQQKKETSADILTQI CCCCCHHHHHHHHHH | 25.65 | 28464351 | |
215 | Ubiquitination | SGSHLEAKVRGLERQ CCCHHHHHHHHHHHH | 24.08 | 22790023 | |
239 | Phosphorylation | RAAKMPRSMEEE--- HHHHCCCCCCCC--- | 25.36 | 26060331 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM109_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM109_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM109_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PHB_HUMAN | PHB | physical | 26496610 | |
ROBO2_HUMAN | ROBO2 | physical | 26496610 | |
RPN2_HUMAN | RPN2 | physical | 26496610 | |
VDAC1_HUMAN | VDAC1 | physical | 26496610 | |
VDAC2_HUMAN | VDAC2 | physical | 26496610 | |
UBP11_HUMAN | USP11 | physical | 26496610 | |
EXO1_HUMAN | EXO1 | physical | 26496610 | |
BAP31_HUMAN | BCAP31 | physical | 26496610 | |
PHB2_HUMAN | PHB2 | physical | 26496610 | |
GOT1B_HUMAN | GOLT1B | physical | 26496610 | |
RMND1_HUMAN | RMND1 | physical | 26496610 | |
ASXL2_HUMAN | ASXL2 | physical | 26496610 | |
TMM43_HUMAN | TMEM43 | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...