UniProt ID | TI50C_DROME | |
---|---|---|
UniProt AC | Q9W4V8 | |
Protein Name | Mitochondrial import inner membrane translocase subunit TIM50-C | |
Gene Name | ttm50 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 428 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein. |
|
Protein Description | Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.. | |
Protein Sequence | MSMSMAPATVLQLLRGLSTPRLLTHIHQHRALGNHYHHYHQHYQHQHHLLHHQQQYLRLFTCTALPAAAPALFSILHTARGYSSTTKQEAGATGPNDAPEVAPNAPLLAKLFPQTSPEVDSNAEQERKKREEEEEKENERAWKRMKLGFAIFGGSAVAAGFWAVYEFGKPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPPYVQPRYTLVLEMKDVLVHPDWTYQTGWRFKKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVLHYYRQFDDPINQFRENQRKLAEQMLEAERIEQSKTKPMVKQWSRNILGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of TI50C_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TI50C_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TI50C_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TI50C_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PYRG_DROME | CTPsyn | physical | 14605208 | |
GNAS_DROME | Galphas | physical | 14605208 | |
PSA1_DROME | Prosalpha6 | physical | 14605208 | |
MOX11_DROME | CG5235 | physical | 14605208 | |
CTBP_DROME | CtBP | physical | 14605208 | |
ITA2_DROME | if | physical | 14605208 | |
DIAP1_DROME | th | genetic | 17435247 | |
HID_DROME | W | genetic | 17435247 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...