dbPTM

MOX11_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MOX11_DROME
UniProt AC	Q9VUY0
Protein Name	MOXD1 homolog 1
Gene Name	CG5235
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	698
Subcellular Localization	Secreted .
Protein Description
Protein Sequence	MSVQDVLWIVLTVQLSFGLAYFENNQRTQDYDVDKNGSVHHKNWVRNEMMDSLGLYWLKWWINANENSIYFEVTVHTRGFAGLGFSKDGRLARADMVLMWVDDATGHPNVLDCHGALHPSSGPPLQDDTQNYDVLDGKQNGTHTILKFKRKIETCDPFDIPLSADTFKVLWSIGENDPIHGNLDWQGQSRGVKALQLFSPMFTKNSHSIEGIQKWDITVNNVTIDRSMDTLYWCKIVRLPELTGKQHIIGYEPLLSGKYERNVVHHMTLFECQSKIYSGSDPSSWDLWVRSAGTVCNSNLLTPRDWDSCSTPVAVWSLGSDGQFLPPHAGIPMGGASGVSYYMLEIHYDNPDGKESVDHSGFRIHYTPNLRTYDSGILISGVSISETQLIPPGQKKYRSVGICGPSCSSVMFPKDGIKIISGTLHSHQAGRTISLRHVRSGKELNPIIVDENYDYRHQKVHQLANETVVLPGDYLITDCSYETKYRKRPTFGGYSTKEEMCLTFITYYPKIEMSGCYSMTPVREFFEMFRVYQFYSLNMTDVENMFLYNSDYTDYSKQAKNATNKPNSGKTSKEDVIYQESLLNKLVISDPAEFHDRTFLSHLNQLPWHDPLFTKRVEQAFITGTHMTFCRVSKDSLSIPSEIIRYPEFTAYVKPPAACLNYLFTDNEELRSGSSQFFTDFTLSLLLLIQLGLQTTLL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	N-linked_Glycosylation	QDYDVDKNGSVHHKN CCEEECCCCCCCCCH	43.43	-
140	N-linked_Glycosylation	DVLDGKQNGTHTILK CCCCCCCCCCEEEEE	61.90	-
221	N-linked_Glycosylation	KWDITVNNVTIDRSM CEEEEEECEEECCCC	28.15	-
465	N-linked_Glycosylation	QKVHQLANETVVLPG HHHHHHCCCEEECCC	54.81	-
538	N-linked_Glycosylation	VYQFYSLNMTDVENM HHEEECCCCCCCEEE	25.93	-
561	N-linked_Glycosylation	DYSKQAKNATNKPNS CHHHHHHHCCCCCCC	55.82	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MOX11_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MOX11_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MOX11_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MOX11_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MOX11_DROME

Related Literatures of Post-Translational Modification