T53I1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: T53I1_HUMAN
• UniProt AC: Q96A56
• Protein Name: Tumor protein p53-inducible nuclear protein 1
• Gene Name: TP53INP1
• Organism: Homo sapiens (Human).
• Sequence Length: 240
• Subcellular Localization: Cytoplasm, cytosol. Nucleus. Nucleus, PML body. Cytoplasmic vesicle, autophagosome. Shuttles between the nucleus and the cytoplasm, depending on cellular stress conditions, and re-localizes to autophagosomes on autophagy activation.
• Protein Description: Antiproliferative and proapoptotic protein involved in cell stress response which acts as a dual regulator of transcription and autophagy. Acts as a positive regulator of autophagy. In response to cellular stress or activation of autophagy, relocates to autophagosomes where it interacts with autophagosome-associated proteins GABARAP, GABARAPL1/L2, MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and plays a major role in p53/TP53-driven oxidative stress response. Possesses both a p53/TP53-independent intracellular reactive oxygen species (ROS) regulatory function and a p53/TP53-dependent transcription regulatory function. Positively regulates p53/TP53 and p73/TP73 and stimulates their capacity to induce apoptosis and regulate cell cycle. In response to double-strand DNA breaks, promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. Acts as a tumor suppressor by inducing cell death by an autophagy and caspase-dependent mechanism. Can reduce cell migration by regulating the expression of SPARC..
• Protein Sequence: MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
142	Phosphorylation	HNSCPGLSEATRGTD CCCCCCCCHHCCCCC	30.97	24719451
148	Phosphorylation	LSEATRGTDELHSPS CCHHCCCCCCCCCCC	24.02	23403867
153	Phosphorylation	RGTDELHSPSSPRVE CCCCCCCCCCCCCHH	38.82	30266825
153 (in isoform 2)	Phosphorylation	-	38.82	25849741
155	Phosphorylation	TDELHSPSSPRVEAQ CCCCCCCCCCCHHHH	56.86	30266825
155 (in isoform 2)	Phosphorylation	-	56.86	25849741
156	Phosphorylation	DELHSPSSPRVEAQN CCCCCCCCCCHHHHH	21.80	23401153
156 (in isoform 2)	Phosphorylation	-	21.80	25849741

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of T53I1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of T53I1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of T53I1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HIPK2_HUMAN	HIPK2	physical	12851404
P53_HUMAN	TP53	physical	12851404
GBRAP_HUMAN	GABARAP	physical	22421968
GBRL2_HUMAN	GABARAPL2	physical	22421968
MLP3A_HUMAN	MAP1LC3A	physical	22421968
SQSTM_HUMAN	SQSTM1	physical	22421968
ZBTB9_HUMAN	ZBTB9	physical	28514442
ASPM_HUMAN	ASPM	physical	28514442
TBCD4_HUMAN	TBC1D4	physical	28514442
YETS2_HUMAN	YEATS2	physical	28514442
CSR2B_HUMAN	CSRP2BP	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.