UniProt ID | STYL1_HUMAN | |
---|---|---|
UniProt AC | Q9Y6J8 | |
Protein Name | Serine/threonine/tyrosine-interacting-like protein 1 | |
Gene Name | STYXL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 313 | |
Subcellular Localization | Mitochondrion matrix . | |
Protein Description | Catalytically inactive phosphatase. [PubMed: 20180778] | |
Protein Sequence | MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | YNILNQATKLSRLTD HHHHHHHHHHHHCCC | 23.82 | 26074081 | |
21 | Ubiquitination | NILNQATKLSRLTDP HHHHHHHHHHHCCCC | 47.70 | - | |
38 | Phosphorylation | LCLLDVRSKWEYDES EEEEECCCCCCCCHH | 41.80 | 23403867 | |
39 (in isoform 5) | Ubiquitination | - | 33.22 | 21906983 | |
39 | Ubiquitination | CLLDVRSKWEYDESH EEEECCCCCCCCHHH | 33.22 | 21906983 | |
39 (in isoform 4) | Ubiquitination | - | 33.22 | 21906983 | |
39 (in isoform 3) | Ubiquitination | - | 33.22 | 21906983 | |
39 (in isoform 2) | Ubiquitination | - | 33.22 | 21906983 | |
39 (in isoform 1) | Ubiquitination | - | 33.22 | 21906983 | |
45 | Phosphorylation | SKWEYDESHVITALR CCCCCCHHHEEEEEE | 21.84 | 23403867 | |
49 | Phosphorylation | YDESHVITALRVKKK CCHHHEEEEEEEEEC | 20.67 | 24719451 | |
56 | Ubiquitination | TALRVKKKNNEYLLP EEEEEEECCCCEECC | 60.32 | - | |
60 | Phosphorylation | VKKKNNEYLLPESVD EEECCCCEECCCCCC | 18.70 | 28152594 | |
65 | Phosphorylation | NEYLLPESVDLECVK CCEECCCCCCCEEEE | 20.99 | 28152594 | |
95 | Phosphorylation | LKDDDDDSDSDGDGK ECCCCCCCCCCCCCC | 46.11 | - | |
97 | Phosphorylation | DDDDDSDSDGDGKDL CCCCCCCCCCCCCCC | 47.66 | - | |
102 | Ubiquitination | SDSDGDGKDLVPQAA CCCCCCCCCCHHHHH | 53.26 | - | |
128 (in isoform 1) | Ubiquitination | - | 40.51 | 21906983 | |
128 (in isoform 2) | Ubiquitination | - | 40.51 | 21906983 | |
128 (in isoform 3) | Ubiquitination | - | 40.51 | 21906983 | |
128 | Ubiquitination | HHPVYILKGGYERFS CCCEEEEECCCCCCC | 40.51 | 21906983 | |
137 | Phosphorylation | GYERFSGTYHFLRTQ CCCCCCEEEEEEEEC | 16.78 | 22210691 | |
145 (in isoform 1) | Ubiquitination | - | 35.23 | 21906983 | |
145 (in isoform 2) | Ubiquitination | - | 35.23 | 21906983 | |
145 | Ubiquitination | YHFLRTQKIIWMPQE EEEEEECEEEEECCC | 35.23 | 2190698 | |
145 (in isoform 3) | Ubiquitination | - | 35.23 | 21906983 | |
180 | Ubiquitination | FSQACDPKIQKDLKI HHHCCCHHHCCCCEE | 44.51 | - | |
278 | Ubiquitination | RSWAYVKKCKNNMCP HHHHHHHHHCCCCCC | 40.16 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STYL1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STYL1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STYL1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AES_HUMAN | AES | physical | 17353931 | |
SMC1A_HUMAN | SMC1A | physical | 17353931 | |
RS29_HUMAN | RPS29 | physical | 17353931 | |
ATX10_HUMAN | ATXN10 | physical | 17353931 | |
EHD4_HUMAN | EHD4 | physical | 17353931 | |
SERB_HUMAN | PSPH | physical | 17353931 | |
ACTS_HUMAN | ACTA1 | physical | 27880917 | |
MYO1B_HUMAN | MYO1B | physical | 27880917 | |
MYO1C_HUMAN | MYO1C | physical | 27880917 | |
SPTN1_HUMAN | SPTAN1 | physical | 27880917 | |
SPTB2_HUMAN | SPTBN1 | physical | 27880917 | |
VIME_HUMAN | VIM | physical | 27880917 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...