UniProt ID | STX2_HUMAN | |
---|---|---|
UniProt AC | P32856 | |
Protein Name | Syntaxin-2 | |
Gene Name | STX2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 288 | |
Subcellular Localization |
Membrane Single-pass type IV membrane protein. |
|
Protein Description | Essential for epithelial morphogenesis. May mediate Ca(2+)-regulation of exocytosis acrosomal reaction in sperm.. | |
Protein Sequence | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Phosphorylation | SIDKITQYVEEVKKN HHHHHHHHHHHHHHH | 10.94 | - | |
55 | Methylation | QYVEEVKKNHSIILS HHHHHHHHHCCEEEC | 66.13 | 23644510 | |
55 | Ubiquitination | QYVEEVKKNHSIILS HHHHHHHHHCCEEEC | 66.13 | 29967540 | |
69 | Ubiquitination | SAPNPEGKIKEELED CCCCCCCCHHHHHHH | 49.28 | 33845483 | |
69 (in isoform 1) | Ubiquitination | - | 49.28 | 21906983 | |
69 (in isoform 2) | Ubiquitination | - | 49.28 | 21906983 | |
69 (in isoform 3) | Ubiquitination | - | 49.28 | 21906983 | |
71 | Methylation | PNPEGKIKEELEDLN CCCCCCHHHHHHHHH | 48.93 | 23644510 | |
87 | Acetylation | EIKKTANKIRAKLKA HHHHHHHHHHHHHHH | 30.98 | 10723465 | |
91 | Acetylation | TANKIRAKLKAIEQS HHHHHHHHHHHHHHH | 40.44 | 10723469 | |
93 | Acetylation | NKIRAKLKAIEQSFD HHHHHHHHHHHHHCC | 46.76 | 10723459 | |
93 | Ubiquitination | NKIRAKLKAIEQSFD HHHHHHHHHHHHHCC | 46.76 | 33845483 | |
125 | Methylation | QHSVLSRKFVEAMAE CCHHHHHHHHHHHHH | 50.84 | 23644510 | |
199 | Acetylation | NEIESRHKDIMKLET HHHHHHHHHHHHHHH | 48.08 | 7662357 | |
240 | Phosphorylation | ERNVMNATDYVEHAK HHHCCCHHHHHHHHH | 23.90 | 28555341 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STX2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STX2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STX2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SNP23_HUMAN | SNAP23 | physical | 12828989 | |
VAMP8_HUMAN | VAMP8 | physical | 12828989 | |
VAMP2_HUMAN | VAMP2 | physical | 12828989 | |
VAMP3_HUMAN | VAMP3 | physical | 12828989 | |
STXB3_HUMAN | STXBP3 | physical | 12773094 | |
SNP23_HUMAN | SNAP23 | physical | 12651853 | |
VAPB_HUMAN | VAPB | physical | 12651853 | |
SNP23_HUMAN | SNAP23 | physical | 9168999 | |
SNP23_MOUSE | Snap23 | physical | 9168999 | |
SNP25_RAT | Snap25 | physical | 9168999 | |
SYT1_HUMAN | SYT1 | physical | 10397765 | |
SNP23_HUMAN | SNAP23 | physical | 8663154 | |
SNP25_HUMAN | SNAP25 | physical | 8663154 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...