| UniProt ID | STX1A_RAT | |
|---|---|---|
| UniProt AC | P32851 | |
| Protein Name | Syntaxin-1A | |
| Gene Name | Stx1a | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 288 | |
| Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Single-pass type IV membrane protein . Cell membrane . Cell junction, synapse, synaptosome . Colocalizes with KCNB1 at the cell membrane (PubMed:17301173). Colocalizes with PLCL1 at |
|
| Protein Description | Plays a role in hormone and neurotransmitter exocytosis. [PubMed: 17301173] | |
| Protein Sequence | MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | DRTQELRTAKDSDDD HHHHHHHHCCCCCCC | 51.16 | 30240740 | |
| 14 | Phosphorylation | ELRTAKDSDDDDDVT HHHHCCCCCCCCCCE | 42.08 | 21187092 | |
| 21 | Phosphorylation | SDDDDDVTVTVDRDR CCCCCCCEEEEEHHH | 19.90 | 25403869 | |
| 23 | Phosphorylation | DDDDVTVTVDRDRFM CCCCCEEEEEHHHHH | 13.81 | 28432305 | |
| 46 | Acetylation | EIRGFIDKIAENVEE HHHHHHHHHHHCHHH | 38.71 | 22902405 | |
| 46 | Ubiquitination | EIRGFIDKIAENVEE HHHHHHHHHHHCHHH | 38.71 | - | |
| 59 | Phosphorylation | EEVKRKHSAILASPN HHHHHHHHHHHCCCC | 21.75 | 28432305 | |
| 64 | Phosphorylation | KHSAILASPNPDEKT HHHHHHCCCCCCHHH | 23.05 | 30411139 | |
| 83 | Acetylation | EELMSDIKKTANKVR HHHHHHHHHHHHHHH | 49.41 | 22902405 | |
| 88 | Acetylation | DIKKTANKVRSKLKS HHHHHHHHHHHHHHH | 36.24 | 22902405 | |
| 92 | Acetylation | TANKVRSKLKSIEQS HHHHHHHHHHHHHHH | 49.74 | 22902405 | |
| 94 | Ubiquitination | NKVRSKLKSIEQSIE HHHHHHHHHHHHHHH | 53.80 | - | |
| 95 | Phosphorylation | KVRSKLKSIEQSIEQ HHHHHHHHHHHHHHH | 41.62 | 25403869 | |
| 99 | Phosphorylation | KLKSIEQSIEQEEGL HHHHHHHHHHHHHCC | 18.46 | 22673903 | |
| 109 | Phosphorylation | QEEGLNRSSADLRIR HHHCCCCCHHHHHHH | 28.89 | 25403869 | |
| 110 | Phosphorylation | EEGLNRSSADLRIRK HHCCCCCHHHHHHHH | 23.67 | 25403869 | |
| 122 | Phosphorylation | IRKTQHSTLSRKFVE HHHHHCCHHHHHHHH | 26.99 | 25403869 | |
| 159 | Phosphorylation | QLEITGRTTTSEELE HHHHHCCCCCHHHHH | 35.45 | 22673903 | |
| 160 | Phosphorylation | LEITGRTTTSEELED HHHHCCCCCHHHHHH | 27.28 | 22673903 | |
| 161 | Phosphorylation | EITGRTTTSEELEDM HHHCCCCCHHHHHHH | 33.26 | 22673903 | |
| 162 | Phosphorylation | ITGRTTTSEELEDML HHCCCCCHHHHHHHH | 27.29 | 22817900 | |
| 188 | Phosphorylation | IIMDSSISKQALSEI EEECCCHHHHHHHHH | 22.21 | 22817900 | |
| 200 | Phosphorylation | SEIETRHSEIIKLEN HHHHHHHHHHHHHHH | 27.48 | 25403869 | |
| 256 | Ubiquitination | SDTKKAVKYQSKARR HHHHHHHHHHHHHHH | 42.29 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 14 | S | Phosphorylation | Kinase | CK2A1 | P68400 | PSP |
| 14 | S | Phosphorylation | Kinase | CSNK2A1 | P19139 | GPS |
| 21 | T | Phosphorylation | Kinase | CSNK1A1 | P48729 | GPS |
| 188 | S | Phosphorylation | Kinase | DAPK1 | P53355 | PSP |
| 188 | S | Phosphorylation | Kinase | DAPK1 | - | PhosphoELM |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STX1A_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| STXB1_RAT | Stxbp1 | physical | 8108429 | |
| STXB1_RAT | Stxbp1 | physical | 21266332 | |
| SNP25_RAT | Snap25 | physical | 21266332 | |
| VAMP2_RAT | Vamp2 | physical | 21266332 | |
| SNP25_MOUSE | Snap25 | physical | 7768895 | |
| STXB1_RAT | Stxbp1 | physical | 7768895 | |
| STXB2_RAT | Stxbp2 | physical | 7768895 | |
| STXB1_RAT | Stxbp1 | physical | 8996080 | |
| HGS_RAT | Hgs | physical | 10825299 | |
| SNP25_RAT | Snap25 | physical | 10825299 | |
| KCNB1_RAT | Kcnb1 | physical | 22411134 | |
| STX1A_RAT | Stx1a | physical | 22411134 | |
| STXB1_RAT | Stxbp1 | physical | 22411134 | |
| SNP25_RAT | Snap25 | physical | 22411134 | |
| VAMP2_RAT | Vamp2 | physical | 22411134 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Ca2+-dependent phosphorylation of syntaxin-1A by the death-associatedprotein (DAP) kinase regulates its interaction with Munc18."; Tian J.H., Das S., Sheng Z.H.; J. Biol. Chem. 278:26265-26274(2003). Cited for: PHOSPHORYLATION AT SER-188, AND INTERACTION WITH DAPK1 AND STKB1. | |