UniProt ID | VAMP2_RAT | |
---|---|---|
UniProt AC | P63045 | |
Protein Name | Vesicle-associated membrane protein 2 | |
Gene Name | Vamp2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 116 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Cell membrane . Neuronal synaptic vesicles. Colocalizes with PRKCZ and WDFY2 in intracellular vesicles. |
|
Protein Description | Involved in the targeting and/or fusion of transport vesicles to their target membrane (By similarity). Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. [PubMed: 19690160] | |
Protein Sequence | MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSATAATVP ------CCCCCCCCC | 34.03 | - | |
52 | Acetylation | IMRVNVDKVLERDQK HHHCCHHHHHHHHHH | 44.42 | 7769519 | |
52 | Ubiquitination | IMRVNVDKVLERDQK HHHCCHHHHHHHHHH | 44.42 | - | |
59 | Acetylation | KVLERDQKLSELDDR HHHHHHHHHHHHHHH | 59.26 | 7769531 | |
59 | Ubiquitination | KVLERDQKLSELDDR HHHHHHHHHHHHHHH | 59.26 | - | |
61 | Phosphorylation | LERDQKLSELDDRAD HHHHHHHHHHHHHHH | 43.05 | 25403869 | |
75 | Phosphorylation | DALQAGASQFETSAA HHHHHHHHHHHHHHH | 34.19 | 30240740 | |
79 | Phosphorylation | AGASQFETSAAKLKR HHHHHHHHHHHHHHH | 25.59 | 27097102 | |
80 | Phosphorylation | GASQFETSAAKLKRK HHHHHHHHHHHHHHH | 21.02 | 27097102 | |
85 | Ubiquitination | ETSAAKLKRKYWWKN HHHHHHHHHHHHHHH | 46.25 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VAMP2_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAMP2_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAMP2_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SNP25_MOUSE | Snap25 | physical | 10644763 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...