| UniProt ID | VAMP2_RAT | |
|---|---|---|
| UniProt AC | P63045 | |
| Protein Name | Vesicle-associated membrane protein 2 | |
| Gene Name | Vamp2 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 116 | |
| Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Cell membrane . Neuronal synaptic vesicles. Colocalizes with PRKCZ and WDFY2 in intracellular vesicles. |
|
| Protein Description | Involved in the targeting and/or fusion of transport vesicles to their target membrane (By similarity). Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. [PubMed: 19690160] | |
| Protein Sequence | MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSATAATVP ------CCCCCCCCC | 34.03 | - | |
| 52 | Acetylation | IMRVNVDKVLERDQK HHHCCHHHHHHHHHH | 44.42 | 7769519 | |
| 52 | Ubiquitination | IMRVNVDKVLERDQK HHHCCHHHHHHHHHH | 44.42 | - | |
| 59 | Acetylation | KVLERDQKLSELDDR HHHHHHHHHHHHHHH | 59.26 | 7769531 | |
| 59 | Ubiquitination | KVLERDQKLSELDDR HHHHHHHHHHHHHHH | 59.26 | - | |
| 61 | Phosphorylation | LERDQKLSELDDRAD HHHHHHHHHHHHHHH | 43.05 | 25403869 | |
| 75 | Phosphorylation | DALQAGASQFETSAA HHHHHHHHHHHHHHH | 34.19 | 30240740 | |
| 79 | Phosphorylation | AGASQFETSAAKLKR HHHHHHHHHHHHHHH | 25.59 | 27097102 | |
| 80 | Phosphorylation | GASQFETSAAKLKRK HHHHHHHHHHHHHHH | 21.02 | 27097102 | |
| 85 | Ubiquitination | ETSAAKLKRKYWWKN HHHHHHHHHHHHHHH | 46.25 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VAMP2_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAMP2_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAMP2_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SNP25_MOUSE | Snap25 | physical | 10644763 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...