| UniProt ID | SRC30_ARATH | |
|---|---|---|
| UniProt AC | Q8L3X8 | |
| Protein Name | Serine/arginine-rich SC35-like splicing factor SCL30 | |
| Gene Name | SCL30 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 262 | |
| Subcellular Localization | Nucleus speckle . | |
| Protein Description | Involved in intron recognition and spliceosome assembly (Probable). Probably active at the 5' splice sites.. | |
| Protein Sequence | MRRYSPPYYSPPRRGYGGRGRSPPPPPPRRGYGGGGGGGGRRGSSHGSLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVASESRKRPEEMRVKTRTRSREPSGSRDRSHGRSRSRSISRSRSPRRPSDSRSRYRSRSYSPAPRRRGGPPRGEEDENYSRRSYSPGYEGAAAAAPDRDRNGDNEIREKPGYEAEDRRRGGRAVSRSPSGSRSRSVEVSPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MRRYSPPYYSP ----CCCCCCCCCCC | 23776212 | ||
| 5 | Phosphorylation | ---MRRYSPPYYSPP ---CCCCCCCCCCCC | 30291188 | ||
| 8 | Phosphorylation | MRRYSPPYYSPPRRG CCCCCCCCCCCCCCC | 24601666 | ||
| 9 | Phosphorylation | RRYSPPYYSPPRRGY CCCCCCCCCCCCCCC | 23776212 | ||
| 10 | Phosphorylation | RYSPPYYSPPRRGYG CCCCCCCCCCCCCCC | 30291188 | ||
| 22 | Phosphorylation | GYGGRGRSPPPPPPR CCCCCCCCCCCCCCC | 30291188 | ||
| 44 | Phosphorylation | GGGGRRGSSHGSLLV CCCCCCCCCCCCEEE | 19880383 | ||
| 48 | Phosphorylation | RRGSSHGSLLVRNIP CCCCCCCCEEEECCC | 29797451 | ||
| 176 | Phosphorylation | PSDSRSRYRSRSYSP CCCCHHHHHHCCCCC | 23776212 | ||
| 178 | Phosphorylation | DSRSRYRSRSYSPAP CCHHHHHHCCCCCCC | 23776212 | ||
| 180 | Phosphorylation | RSRYRSRSYSPAPRR HHHHHHCCCCCCCCC | 23776212 | ||
| 181 | Phosphorylation | SRYRSRSYSPAPRRR HHHHHCCCCCCCCCC | 23776212 | ||
| 182 | Phosphorylation | RYRSRSYSPAPRRRG HHHHCCCCCCCCCCC | 23776212 | ||
| 200 | Phosphorylation | RGEEDENYSRRSYSP CCCCCCCCCCCCCCC | 23111157 | ||
| 201 | Phosphorylation | GEEDENYSRRSYSPG CCCCCCCCCCCCCCC | 30407730 | ||
| 204 | Phosphorylation | DENYSRRSYSPGYEG CCCCCCCCCCCCCCC | 30291188 | ||
| 205 | Phosphorylation | ENYSRRSYSPGYEGA CCCCCCCCCCCCCCC | 24601666 | ||
| 206 | Phosphorylation | NYSRRSYSPGYEGAA CCCCCCCCCCCCCCH | 30291188 | ||
| 209 | Phosphorylation | RRSYSPGYEGAAAAA CCCCCCCCCCCHHHC | 19880383 | ||
| 246 | Phosphorylation | RRGGRAVSRSPSGSR HCCCCEECCCCCCCC | 29654922 | ||
| 248 | Phosphorylation | GGRAVSRSPSGSRSR CCCEECCCCCCCCCC | 25561503 | ||
| 252 | Phosphorylation | VSRSPSGSRSRSVEV ECCCCCCCCCCCEEE | 29654922 | ||
| 254 | Phosphorylation | RSPSGSRSRSVEVSP CCCCCCCCCCEEECC | 23776212 | ||
| 256 | Phosphorylation | PSGSRSRSVEVSPR- CCCCCCCCEEECCC- | 19880383 | ||
| 260 | Phosphorylation | RSRSVEVSPR----- CCCCEEECCC----- | 23776212 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRC30_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRC30_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRC30_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RSZ21_ARATH | RSZP21 | physical | 18674533 | |
| SR30_ARATH | ATSRP30 | physical | 18674533 | |
| SR34_ARATH | SR1 | physical | 18674533 | |
| SRC28_ARATH | SCL28 | physical | 18674533 | |
| SRC30_ARATH | SCL30 | physical | 18674533 | |
| SL30A_ARATH | SCL30A | physical | 18674533 | |
| RSZ33_ARATH | RSZ33 | physical | 12176998 | |
| RZ1C_ARATH | AT5G04280 | physical | 21798944 | |
| AFC3_ARATH | AME3 | physical | 21798944 | |
| U2AFB_ARATH | U2AF35B | physical | 21798944 | |
| SRC30_ARATH | SCL30 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...