UniProt ID | SRC30_ARATH | |
---|---|---|
UniProt AC | Q8L3X8 | |
Protein Name | Serine/arginine-rich SC35-like splicing factor SCL30 | |
Gene Name | SCL30 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 262 | |
Subcellular Localization | Nucleus speckle . | |
Protein Description | Involved in intron recognition and spliceosome assembly (Probable). Probably active at the 5' splice sites.. | |
Protein Sequence | MRRYSPPYYSPPRRGYGGRGRSPPPPPPRRGYGGGGGGGGRRGSSHGSLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVASESRKRPEEMRVKTRTRSREPSGSRDRSHGRSRSRSISRSRSPRRPSDSRSRYRSRSYSPAPRRRGGPPRGEEDENYSRRSYSPGYEGAAAAAPDRDRNGDNEIREKPGYEAEDRRRGGRAVSRSPSGSRSRSVEVSPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MRRYSPPYYSP ----CCCCCCCCCCC | 23776212 | ||
5 | Phosphorylation | ---MRRYSPPYYSPP ---CCCCCCCCCCCC | 30291188 | ||
8 | Phosphorylation | MRRYSPPYYSPPRRG CCCCCCCCCCCCCCC | 24601666 | ||
9 | Phosphorylation | RRYSPPYYSPPRRGY CCCCCCCCCCCCCCC | 23776212 | ||
10 | Phosphorylation | RYSPPYYSPPRRGYG CCCCCCCCCCCCCCC | 30291188 | ||
22 | Phosphorylation | GYGGRGRSPPPPPPR CCCCCCCCCCCCCCC | 30291188 | ||
44 | Phosphorylation | GGGGRRGSSHGSLLV CCCCCCCCCCCCEEE | 19880383 | ||
48 | Phosphorylation | RRGSSHGSLLVRNIP CCCCCCCCEEEECCC | 29797451 | ||
176 | Phosphorylation | PSDSRSRYRSRSYSP CCCCHHHHHHCCCCC | 23776212 | ||
178 | Phosphorylation | DSRSRYRSRSYSPAP CCHHHHHHCCCCCCC | 23776212 | ||
180 | Phosphorylation | RSRYRSRSYSPAPRR HHHHHHCCCCCCCCC | 23776212 | ||
181 | Phosphorylation | SRYRSRSYSPAPRRR HHHHHCCCCCCCCCC | 23776212 | ||
182 | Phosphorylation | RYRSRSYSPAPRRRG HHHHCCCCCCCCCCC | 23776212 | ||
200 | Phosphorylation | RGEEDENYSRRSYSP CCCCCCCCCCCCCCC | 23111157 | ||
201 | Phosphorylation | GEEDENYSRRSYSPG CCCCCCCCCCCCCCC | 30407730 | ||
204 | Phosphorylation | DENYSRRSYSPGYEG CCCCCCCCCCCCCCC | 30291188 | ||
205 | Phosphorylation | ENYSRRSYSPGYEGA CCCCCCCCCCCCCCC | 24601666 | ||
206 | Phosphorylation | NYSRRSYSPGYEGAA CCCCCCCCCCCCCCH | 30291188 | ||
209 | Phosphorylation | RRSYSPGYEGAAAAA CCCCCCCCCCCHHHC | 19880383 | ||
246 | Phosphorylation | RRGGRAVSRSPSGSR HCCCCEECCCCCCCC | 29654922 | ||
248 | Phosphorylation | GGRAVSRSPSGSRSR CCCEECCCCCCCCCC | 25561503 | ||
252 | Phosphorylation | VSRSPSGSRSRSVEV ECCCCCCCCCCCEEE | 29654922 | ||
254 | Phosphorylation | RSPSGSRSRSVEVSP CCCCCCCCCCEEECC | 23776212 | ||
256 | Phosphorylation | PSGSRSRSVEVSPR- CCCCCCCCEEECCC- | 19880383 | ||
260 | Phosphorylation | RSRSVEVSPR----- CCCCEEECCC----- | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRC30_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRC30_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRC30_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RSZ21_ARATH | RSZP21 | physical | 18674533 | |
SR30_ARATH | ATSRP30 | physical | 18674533 | |
SR34_ARATH | SR1 | physical | 18674533 | |
SRC28_ARATH | SCL28 | physical | 18674533 | |
SRC30_ARATH | SCL30 | physical | 18674533 | |
SL30A_ARATH | SCL30A | physical | 18674533 | |
RSZ33_ARATH | RSZ33 | physical | 12176998 | |
RZ1C_ARATH | AT5G04280 | physical | 21798944 | |
AFC3_ARATH | AME3 | physical | 21798944 | |
U2AFB_ARATH | U2AF35B | physical | 21798944 | |
SRC30_ARATH | SCL30 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...