| UniProt ID | SR34_ARATH | |
|---|---|---|
| UniProt AC | O22315 | |
| Protein Name | Serine/arginine-rich-splicing factor SR34 | |
| Gene Name | SR34 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 303 | |
| Subcellular Localization | Nucleus speckle . Nucleus, nucleoplasm . | |
| Protein Description | General splicing factor. Can promote splice site selection in vitro presumably by antagonizing the effects of the A1 heterogeneous nuclear ribonucleoprotein. May have an essential function during early plant development.. | |
| Protein Sequence | MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGGRRSSDDTRGSFNGGGRGGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHMRKGGDVCFSQVYRDARGTTGVVDYTCYEDMKYALKKLDDTEFRNAFSNGYVRVREYDSRKDSRSPSRGRSYSKSRSRSRGRSVSRSRSRSRSRSRSPKAKSSRRSPAKSTSRSPGPRSKSRSPSPRRSRSRSRSPLPSVQKEGSKSPSKPSPAKSPIHTRSPSR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 110 | Phosphorylation | RGRGDGGSRGPSRRS CCCCCCCCCCCCCHH | 24894044 | ||
| 128 | Phosphorylation | VLVTGLPSSASWQDL EEEECCCCCCCHHHH | 19880383 | ||
| 129 | Phosphorylation | LVTGLPSSASWQDLK EEECCCCCCCHHHHH | 30407730 | ||
| 131 | Phosphorylation | TGLPSSASWQDLKDH ECCCCCCCHHHHHHH | 30291188 | ||
| 269 | Phosphorylation | PSPRRSRSRSRSPLP CCCCCCCCCCCCCCC | 23776212 | ||
| 271 | Phosphorylation | PRRSRSRSRSPLPSV CCCCCCCCCCCCCCC | 23776212 | ||
| 273 | Phosphorylation | RSRSRSRSPLPSVQK CCCCCCCCCCCCCCC | 23776212 | ||
| 277 | Phosphorylation | RSRSPLPSVQKEGSK CCCCCCCCCCCCCCC | 23776212 | ||
| 283 | Phosphorylation | PSVQKEGSKSPSKPS CCCCCCCCCCCCCCC | 23776212 | ||
| 285 | Phosphorylation | VQKEGSKSPSKPSPA CCCCCCCCCCCCCCC | 23776212 | ||
| 287 | Phosphorylation | KEGSKSPSKPSPAKS CCCCCCCCCCCCCCC | 23776212 | ||
| 290 | Phosphorylation | SKSPSKPSPAKSPIH CCCCCCCCCCCCCCC | 23776212 | ||
| 294 | Phosphorylation | SKPSPAKSPIHTRSP CCCCCCCCCCCCCCC | 23776212 | ||
| 298 | Phosphorylation | PAKSPIHTRSPSR-- CCCCCCCCCCCCC-- | 23776212 | ||
| 300 | Phosphorylation | KSPIHTRSPSR---- CCCCCCCCCCC---- | 28011693 | ||
| 302 | Phosphorylation | PIHTRSPSR------ CCCCCCCCC------ | 28011693 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SR34_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SR34_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SR34_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CNBL2_ARATH | CBL2 | physical | 11577192 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
