UniProt ID | SR34_ARATH | |
---|---|---|
UniProt AC | O22315 | |
Protein Name | Serine/arginine-rich-splicing factor SR34 | |
Gene Name | SR34 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 303 | |
Subcellular Localization | Nucleus speckle . Nucleus, nucleoplasm . | |
Protein Description | General splicing factor. Can promote splice site selection in vitro presumably by antagonizing the effects of the A1 heterogeneous nuclear ribonucleoprotein. May have an essential function during early plant development.. | |
Protein Sequence | MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGGRRSSDDTRGSFNGGGRGGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHMRKGGDVCFSQVYRDARGTTGVVDYTCYEDMKYALKKLDDTEFRNAFSNGYVRVREYDSRKDSRSPSRGRSYSKSRSRSRGRSVSRSRSRSRSRSRSPKAKSSRRSPAKSTSRSPGPRSKSRSPSPRRSRSRSRSPLPSVQKEGSKSPSKPSPAKSPIHTRSPSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
110 | Phosphorylation | RGRGDGGSRGPSRRS CCCCCCCCCCCCCHH | 24894044 | ||
128 | Phosphorylation | VLVTGLPSSASWQDL EEEECCCCCCCHHHH | 19880383 | ||
129 | Phosphorylation | LVTGLPSSASWQDLK EEECCCCCCCHHHHH | 30407730 | ||
131 | Phosphorylation | TGLPSSASWQDLKDH ECCCCCCCHHHHHHH | 30291188 | ||
269 | Phosphorylation | PSPRRSRSRSRSPLP CCCCCCCCCCCCCCC | 23776212 | ||
271 | Phosphorylation | PRRSRSRSRSPLPSV CCCCCCCCCCCCCCC | 23776212 | ||
273 | Phosphorylation | RSRSRSRSPLPSVQK CCCCCCCCCCCCCCC | 23776212 | ||
277 | Phosphorylation | RSRSPLPSVQKEGSK CCCCCCCCCCCCCCC | 23776212 | ||
283 | Phosphorylation | PSVQKEGSKSPSKPS CCCCCCCCCCCCCCC | 23776212 | ||
285 | Phosphorylation | VQKEGSKSPSKPSPA CCCCCCCCCCCCCCC | 23776212 | ||
287 | Phosphorylation | KEGSKSPSKPSPAKS CCCCCCCCCCCCCCC | 23776212 | ||
290 | Phosphorylation | SKSPSKPSPAKSPIH CCCCCCCCCCCCCCC | 23776212 | ||
294 | Phosphorylation | SKPSPAKSPIHTRSP CCCCCCCCCCCCCCC | 23776212 | ||
298 | Phosphorylation | PAKSPIHTRSPSR-- CCCCCCCCCCCCC-- | 23776212 | ||
300 | Phosphorylation | KSPIHTRSPSR---- CCCCCCCCCCC---- | 28011693 | ||
302 | Phosphorylation | PIHTRSPSR------ CCCCCCCCC------ | 28011693 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SR34_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SR34_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SR34_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CNBL2_ARATH | CBL2 | physical | 11577192 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...