UniProt ID | RZ1C_ARATH | |
---|---|---|
UniProt AC | Q8RWN5 | |
Protein Name | Glycine-rich RNA-binding protein RZ1C {ECO:0000305} | |
Gene Name | RZ1C {ECO:0000305} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 310 | |
Subcellular Localization | Nucleus . | |
Protein Description | Binds RNA and DNA sequences non-specifically. May be involved in tolerance to cold stress.. | |
Protein Sequence | MAAKEGSRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPKLGRDDGESHGSRGGRDSGYSIAGKGSFGGGGGGGGRVGEDECFKCGRVGHWARDCPSAGGGRGGPVGGFSSRASAYGGSDGRVDRYADRDRYVDRERYIDDRYDGAARYGARDRFDSREAYIPRDRYASDRYAAPADRFAGGDRYSRGSDRYPPGSYDKARSFERDIAPSAGSDRYGGGRAGGPIRGGGEEGRGFRSRAGAPYERPSRSGGGGAYPSSSTFDRY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | RIFVGGLSPEVTDRD EEEECCCCCCCCHHH | 30291188 | ||
19 | Phosphorylation | GGLSPEVTDRDLERA CCCCCCCCHHHHHHH | 19376835 | ||
105 | Phosphorylation | RGGRDSGYSIAGKGS CCCCCCCCCCCCCCC | 25561503 | ||
106 | Phosphorylation | GGRDSGYSIAGKGSF CCCCCCCCCCCCCCC | 25561503 | ||
112 | Phosphorylation | YSIAGKGSFGGGGGG CCCCCCCCCCCCCCC | 25561503 | ||
160 | Phosphorylation | GGFSSRASAYGGSDG CCCCCCCCCCCCCCC | 25561503 | ||
162 | Phosphorylation | FSSRASAYGGSDGRV CCCCCCCCCCCCCCC | 25561503 | ||
165 | Phosphorylation | RASAYGGSDGRVDRY CCCCCCCCCCCCCCC | 30407730 | ||
203 | Phosphorylation | GARDRFDSREAYIPR CCCCCCCCCCCCCCC | 25561503 | ||
232 | Phosphorylation | FAGGDRYSRGSDRYP CCCCCCCCCCCCCCC | 30407730 | ||
248 | Phosphorylation | GSYDKARSFERDIAP CCHHHHHCCCCCCCC | 29654922 | ||
259 | Phosphorylation | DIAPSAGSDRYGGGR CCCCCCCCCCCCCCC | 25561503 | ||
293 | Phosphorylation | GAPYERPSRSGGGGA CCCCCCCCCCCCCCC | 30407730 | ||
295 | Phosphorylation | PYERPSRSGGGGAYP CCCCCCCCCCCCCCC | 19376835 | ||
303 | Phosphorylation | GGGGAYPSSSTFDRY CCCCCCCCCCCCCCC | 29654922 | ||
305 | Phosphorylation | GGAYPSSSTFDRY-- CCCCCCCCCCCCC-- | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RZ1C_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RZ1C_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RZ1C_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
C3H52_ARATH | AT5G06770 | physical | 21798944 | |
RZ1C_ARATH | AT5G04280 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...