SDHF3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SDHF3_HUMAN
• UniProt AC: Q9NRP4
• Protein Name: Succinate dehydrogenase assembly factor 3, mitochondrial {ECO:0000250|UniProtKB:Q04401, ECO:0000312|HGNC:HGNC:21752}
• Gene Name: SDHAF3 {ECO:0000312|HGNC:HGNC:21752}
• Organism: Homo sapiens (Human).
• Sequence Length: 125
• Subcellular Localization: Mitochondrion matrix .
• Protein Description: Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SDHB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF1..
• Protein Sequence: MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
116	Phosphorylation	TKPNRQFSISESMKP CCCCCCCCCCHHCCC		62171603

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SDHF3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SDHF3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SDHF3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SDHF4_HUMAN	C6orf57	physical	26186194
ACPM_HUMAN	NDUFAB1	physical	26186194
BOLA3_HUMAN	BOLA3	physical	27499296
MPPA_HUMAN	PMPCA	physical	27499296
GOLP3_HUMAN	GOLPH3	physical	27499296
ACPM_HUMAN	NDUFAB1	physical	27499296
ECH1_HUMAN	ECH1	physical	27499296
PPA6_HUMAN	ACP6	physical	27499296
GLRX5_HUMAN	GLRX5	physical	27499296
SDHB_HUMAN	SDHB	physical	27499296
C1QBP_HUMAN	C1QBP	physical	27499296
ATP5J_HUMAN	ATP5J	physical	27499296
SDHB_HUMAN	SDHB	physical	28514442
SDHF4_HUMAN	C6orf57	physical	28514442
ACPM_HUMAN	NDUFAB1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.