| UniProt ID | RSLAB_HUMAN | |
|---|---|---|
| UniProt AC | Q96S79 | |
| Protein Name | Ras-like protein family member 10B | |
| Gene Name | RASL10B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 203 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | May facilitate the release of atrial natriuretic peptide by cardiomyocytes and hence play a role in the regulation of arterial pressure.. | |
| Protein Sequence | MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAIM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MVSTYRVAVL -----CCCEEEEEEE | 20.58 | 22210691 | |
| 4 | Phosphorylation | ----MVSTYRVAVLG ----CCCEEEEEEEC | 12.16 | 22210691 | |
| 5 | Phosphorylation | ---MVSTYRVAVLGA ---CCCEEEEEEECC | 8.79 | 22210691 | |
| 18 | Phosphorylation | GARGVGKSAIVRQFL CCCCCCHHHHHHHHH | 19.80 | - | |
| 36 | Phosphorylation | FSEVCVPTTARRLYL CCCCCCCCCCCCCCC | 16.82 | - | |
| 118 | Phosphorylation | LETRVIGTSETPIII HHHEECCCCCCCEEE | 16.56 | 30624053 | |
| 119 | Phosphorylation | ETRVIGTSETPIIIV HHEECCCCCCCEEEE | 33.97 | 30624053 | |
| 121 | Phosphorylation | RVIGTSETPIIIVGN EECCCCCCCEEEECC | 21.39 | 30624053 | |
| 200 | Methylation | GALRRNRCAIM---- HHHHCCCEECC---- | 3.25 | - | |
| 200 | Geranylgeranylation | GALRRNRCAIM---- HHHHCCCEECC---- | 3.25 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RSLAB_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RSLAB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RSLAB_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| SAHH3_HUMAN | AHCYL2 | physical | 28514442 | |
| MMAD_HUMAN | MMADHC | physical | 28514442 | |
| F192A_HUMAN | FAM192A | physical | 28514442 | |
| PSME3_HUMAN | PSME3 | physical | 28514442 | |
| SAHH2_HUMAN | AHCYL1 | physical | 28514442 | |
| ZN507_HUMAN | ZNF507 | physical | 28514442 | |
| MK09_HUMAN | MAPK9 | physical | 28514442 | |
| CH60_HUMAN | HSPD1 | physical | 28514442 | |
| PSMG3_HUMAN | PSMG3 | physical | 28514442 | |
| NDUF7_HUMAN | NDUFAF7 | physical | 28514442 | |
| LONM_HUMAN | LONP1 | physical | 28514442 | |
| TARB1_HUMAN | TARBP1 | physical | 28514442 | |
| UBB_HUMAN | UBB | physical | 28514442 | |
| PASK_HUMAN | PASK | physical | 28514442 | |
| NDUS6_HUMAN | NDUFS6 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...