UniProt ID | RSLAB_HUMAN | |
---|---|---|
UniProt AC | Q96S79 | |
Protein Name | Ras-like protein family member 10B | |
Gene Name | RASL10B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 203 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | May facilitate the release of atrial natriuretic peptide by cardiomyocytes and hence play a role in the regulation of arterial pressure.. | |
Protein Sequence | MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAIM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MVSTYRVAVL -----CCCEEEEEEE | 20.58 | 22210691 | |
4 | Phosphorylation | ----MVSTYRVAVLG ----CCCEEEEEEEC | 12.16 | 22210691 | |
5 | Phosphorylation | ---MVSTYRVAVLGA ---CCCEEEEEEECC | 8.79 | 22210691 | |
18 | Phosphorylation | GARGVGKSAIVRQFL CCCCCCHHHHHHHHH | 19.80 | - | |
36 | Phosphorylation | FSEVCVPTTARRLYL CCCCCCCCCCCCCCC | 16.82 | - | |
118 | Phosphorylation | LETRVIGTSETPIII HHHEECCCCCCCEEE | 16.56 | 30624053 | |
119 | Phosphorylation | ETRVIGTSETPIIIV HHEECCCCCCCEEEE | 33.97 | 30624053 | |
121 | Phosphorylation | RVIGTSETPIIIVGN EECCCCCCCEEEECC | 21.39 | 30624053 | |
200 | Methylation | GALRRNRCAIM---- HHHHCCCEECC---- | 3.25 | - | |
200 | Geranylgeranylation | GALRRNRCAIM---- HHHHCCCEECC---- | 3.25 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RSLAB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RSLAB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RSLAB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
SAHH3_HUMAN | AHCYL2 | physical | 28514442 | |
MMAD_HUMAN | MMADHC | physical | 28514442 | |
F192A_HUMAN | FAM192A | physical | 28514442 | |
PSME3_HUMAN | PSME3 | physical | 28514442 | |
SAHH2_HUMAN | AHCYL1 | physical | 28514442 | |
ZN507_HUMAN | ZNF507 | physical | 28514442 | |
MK09_HUMAN | MAPK9 | physical | 28514442 | |
CH60_HUMAN | HSPD1 | physical | 28514442 | |
PSMG3_HUMAN | PSMG3 | physical | 28514442 | |
NDUF7_HUMAN | NDUFAF7 | physical | 28514442 | |
LONM_HUMAN | LONP1 | physical | 28514442 | |
TARB1_HUMAN | TARBP1 | physical | 28514442 | |
UBB_HUMAN | UBB | physical | 28514442 | |
PASK_HUMAN | PASK | physical | 28514442 | |
NDUS6_HUMAN | NDUFS6 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...