UniProt ID | RRG7_YEAST | |
---|---|---|
UniProt AC | Q08774 | |
Protein Name | Required for respiratory growth protein 7, mitochondrial | |
Gene Name | RRG7 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 242 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MIKNYLGRRWLNNPAIQAYVKQNAAVAHSTVFQGNLYEYTVMRELSEKLRMTKLRKTGGAHDGGVDIKGSWPVDDIYWKISSLMPNLEMASNIKRTNSQNGFVLKPLKYRIIDHTFEPLKVLVQCKAFTKSKLSPREFRELVGTFTSLVSHSQRNKTVCIMCSPHMLTKDTLNLINNITLPLIYLRVEMLKEKTDGHFDLINSGKLINYYENSYASTLMQDCKISEWLKLKLYKNSDFNSEK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRG7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRG7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRG7_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YEC3_YEAST | YEL023C | physical | 16554755 | |
SMD2_YEAST | SMD2 | physical | 16554755 | |
RUXE_YEAST | SME1 | physical | 16554755 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
APC4_YEAST | APC4 | genetic | 27708008 | |
TAF12_YEAST | TAF12 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
CDC26_YEAST | CDC26 | genetic | 27708008 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
GPI13_YEAST | GPI13 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
CDC3_YEAST | CDC3 | genetic | 27708008 | |
TAF4_YEAST | TAF4 | genetic | 27708008 | |
LCB1_YEAST | LCB1 | genetic | 27708008 | |
DPOA_YEAST | POL1 | genetic | 27708008 | |
PROF_YEAST | PFY1 | genetic | 27708008 | |
BUR1_YEAST | SGV1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...