| UniProt ID | RHOJ_HUMAN | |
|---|---|---|
| UniProt AC | Q9H4E5 | |
| Protein Name | Rho-related GTP-binding protein RhoJ | |
| Gene Name | RHOJ | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 214 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | GTP-binding protein with GTPase activity. Elicits the formation of F-actin-rich structures in fibroblasts and is involved in the regulation of cell morphology (By similarity).. | |
| Protein Sequence | MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | S-palmitoylation | -----MNCKEGTDSS -----CCCCCCCCCC | 4.02 | 30158707 | |
| 7 | Phosphorylation | -MNCKEGTDSSCGCR -CCCCCCCCCCCCCC | 33.52 | 22817900 | |
| 10 | Phosphorylation | CKEGTDSSCGCRGND CCCCCCCCCCCCCCC | 19.82 | 19690332 | |
| 11 | S-palmitoylation | KEGTDSSCGCRGNDE CCCCCCCCCCCCCCC | 7.45 | 30158707 | |
| 24 | S-palmitoylation | DEKKMLKCVVVGDGA CCCCCEEEEEECCCC | 2.18 | 29575903 | |
| 211 | Methylation | CSEGHSCCSII---- CCCCCCCCCCC---- | 3.52 | - | |
| 211 | Farnesylation | CSEGHSCCSII---- CCCCCCCCCCC---- | 3.52 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHOJ_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHOJ_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHOJ_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| WASP_HUMAN | WAS | physical | 10967094 | |
| PAK1_HUMAN | PAK1 | physical | 10967094 | |
| PAR6B_HUMAN | PARD6B | physical | 25416956 | |
| IF2P_HUMAN | EIF5B | physical | 26186194 | |
| KPCI_HUMAN | PRKCI | physical | 26186194 | |
| PAK2_HUMAN | PAK2 | physical | 26186194 | |
| KC1D_HUMAN | CSNK1D | physical | 26186194 | |
| F177A_HUMAN | FAM177A1 | physical | 26186194 | |
| PAR6B_HUMAN | PARD6B | physical | 26186194 | |
| UBP24_HUMAN | USP24 | physical | 26186194 | |
| AASD1_HUMAN | AARSD1 | physical | 26186194 | |
| PAR6B_HUMAN | PARD6B | physical | 28514442 | |
| PAR6G_HUMAN | PARD6G | physical | 28514442 | |
| UBP24_HUMAN | USP24 | physical | 28514442 | |
| F177A_HUMAN | FAM177A1 | physical | 28514442 | |
| PAK1_HUMAN | PAK1 | physical | 28514442 | |
| KPCI_HUMAN | PRKCI | physical | 28514442 | |
| PAK2_HUMAN | PAK2 | physical | 28514442 | |
| AASD1_HUMAN | AARSD1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-7, AND MASSSPECTROMETRY. | |
