RHES_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RHES_HUMAN
• UniProt AC: Q96D21
• Protein Name: GTP-binding protein Rhes
• Gene Name: RASD2
• Organism: Homo sapiens (Human).
• Sequence Length: 266
• Subcellular Localization: Cell membrane; Lipid-anchor.
• Protein Description: GTPase signaling protein that binds to and hydrolyzes GTP. Regulates signaling pathways involving G-proteins-coupled receptor and heterotrimeric proteins such as GNB1, GNB2 and GNB3. May be involved in selected striatal competencies, mainly locomotor activity and motor coordination..
• Protein Sequence: MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MMKTLSSGNCT ----CCCCCCCCCEE	17.61	20068231
6	Phosphorylation	--MMKTLSSGNCTLS --CCCCCCCCCEEEE	41.24	24719451
7	Phosphorylation	-MMKTLSSGNCTLSV -CCCCCCCCCEEEEE	36.82	20068231
11	Phosphorylation	TLSSGNCTLSVPAKN CCCCCCEEEEEECCC	26.52	20068231
13	Phosphorylation	SSGNCTLSVPAKNSY CCCCEEEEEECCCCE	14.11	20068231
19	Phosphorylation	LSVPAKNSYRMVVLG EEEECCCCEEEEEEE	17.26	20068231
20	Phosphorylation	SVPAKNSYRMVVLGA EEECCCCEEEEEEEC	16.48	22210691
161	Phosphorylation	TEAELLVSGDENCAY CCEEEEECCCCCEEE	40.26	-
205	Phosphorylation	PALHRKISVQYGDAF HHHHCCEEECCCCCC	13.25	23312004
208	Phosphorylation	HRKISVQYGDAFHPR HCCEEECCCCCCCCC	18.15	23312004
228	Phosphorylation	RVKEMDAYGMVSPFA CHHHHCCCCCCCCCC	11.07	30177828
232	Phosphorylation	MDAYGMVSPFARRPS HCCCCCCCCCCCCCC	12.86	30177828
239	Phosphorylation	SPFARRPSVNSDLKY CCCCCCCCCCCCHHH	31.92	26657352
242	Phosphorylation	ARRPSVNSDLKYIKA CCCCCCCCCHHHHHH	42.01	29083192
246	Phosphorylation	SVNSDLKYIKAKVLR CCCCCHHHHHHHHHH	18.23	29083192
263	Farnesylation	QARERDKCTIQ---- CCCCCCCCCCC----	4.79	-
263	Methylation	QARERDKCTIQ---- CCCCCCCCCCC----	4.79	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
239	S	Phosphorylation	Kinase	PKACA	P17612	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RHES_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RHES_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB1_HUMAN	GNB1	physical	19255495
GBB2_HUMAN	GNB2	physical	19255495
GBB3_HUMAN	GNB3	physical	19255495
PRAF1_HUMAN	RABAC1	physical	19060904
LRP5_HUMAN	LRP5	physical	26186194
LRP6_HUMAN	LRP6	physical	26186194
GDS1_HUMAN	RAP1GDS1	physical	26186194
S4A7_HUMAN	SLC4A7	physical	26186194
AKT1_HUMAN	AKT1	physical	22683505
P85A_HUMAN	PIK3R1	physical	22683505
S4A7_HUMAN	SLC4A7	physical	28514442
LRP6_HUMAN	LRP6	physical	28514442
LRP5_HUMAN	LRP5	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.